Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 2310815..2311392 | Replicon | chromosome |
Accession | NZ_CP102483 | ||
Organism | Burkholderia contaminans strain DM32 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NTJ56_RS28550 | Protein ID | WP_226220494.1 |
Coordinates | 2311027..2311392 (+) | Length | 122 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | U2HEK9 |
Locus tag | NTJ56_RS28545 | Protein ID | WP_021160898.1 |
Coordinates | 2310815..2311033 (+) | Length | 73 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NTJ56_RS28520 (NTJ56_28520) | 2306086..2306565 | + | 480 | WP_226116504.1 | GNAT family N-acetyltransferase | - |
NTJ56_RS28525 (NTJ56_28525) | 2306656..2307921 | - | 1266 | WP_226116502.1 | Zn-dependent hydrolase | - |
NTJ56_RS28530 (NTJ56_28530) | 2307914..2308438 | - | 525 | WP_226220497.1 | L-2-amino-thiazoline-4-carboxylic acid hydrolase | - |
NTJ56_RS28535 (NTJ56_28535) | 2308483..2309649 | - | 1167 | WP_226220496.1 | branched-chain amino acid ABC transporter substrate-binding protein | - |
NTJ56_RS28540 (NTJ56_28540) | 2309828..2310724 | + | 897 | WP_226220495.1 | LysR substrate-binding domain-containing protein | - |
NTJ56_RS28545 (NTJ56_28545) | 2310815..2311033 | + | 219 | WP_021160898.1 | hypothetical protein | Antitoxin |
NTJ56_RS28550 (NTJ56_28550) | 2311027..2311392 | + | 366 | WP_226220494.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NTJ56_RS28555 (NTJ56_28555) | 2311732..2312295 | + | 564 | WP_011547973.1 | alkyl hydroperoxide reductase subunit C | - |
NTJ56_RS28560 (NTJ56_28560) | 2312419..2314017 | + | 1599 | WP_226116496.1 | alkyl hydroperoxide reductase subunit F | - |
NTJ56_RS28565 (NTJ56_28565) | 2314112..2314894 | - | 783 | WP_226220493.1 | extensin | - |
NTJ56_RS28570 (NTJ56_28570) | 2315055..2315609 | - | 555 | WP_226116492.1 | carboxymuconolactone decarboxylase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 122 a.a. Molecular weight: 13421.47 Da Isoelectric Point: 8.4389
>T253730 WP_226220494.1 NZ_CP102483:2311027-2311392 [Burkholderia contaminans]
MVKALFDTNILIDYLGGVESARAELGRYDYRAISTISWMEVLVGTSAQDEAPIRAWLSSFDVIALDSPVASRAVTIRKER
RIRLPDAIVWASAQVNGLLLVSRNTKDFPATEPGVRVPYKL
MVKALFDTNILIDYLGGVESARAELGRYDYRAISTISWMEVLVGTSAQDEAPIRAWLSSFDVIALDSPVASRAVTIRKER
RIRLPDAIVWASAQVNGLLLVSRNTKDFPATEPGVRVPYKL
Download Length: 366 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|