Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1789069..1789708 | Replicon | chromosome |
| Accession | NZ_CP102483 | ||
| Organism | Burkholderia contaminans strain DM32 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NTJ56_RS26285 | Protein ID | WP_226220940.1 |
| Coordinates | 1789292..1789708 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A1X1PQC0 |
| Locus tag | NTJ56_RS26280 | Protein ID | WP_039351245.1 |
| Coordinates | 1789069..1789305 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTJ56_RS26265 (NTJ56_26265) | 1784828..1786408 | + | 1581 | WP_226220718.1 | FadD3 family acyl-CoA ligase | - |
| NTJ56_RS26270 (NTJ56_26270) | 1786477..1787220 | + | 744 | WP_226220717.1 | SDR family oxidoreductase | - |
| NTJ56_RS26275 (NTJ56_26275) | 1788012..1788671 | + | 660 | WP_226122407.1 | hypothetical protein | - |
| NTJ56_RS26280 (NTJ56_26280) | 1789069..1789305 | + | 237 | WP_039351245.1 | DNA-binding protein | Antitoxin |
| NTJ56_RS26285 (NTJ56_26285) | 1789292..1789708 | + | 417 | WP_226220940.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NTJ56_RS26290 (NTJ56_26290) | 1790064..1791509 | - | 1446 | WP_226220716.1 | GSCFA domain-containing protein | - |
| NTJ56_RS26295 (NTJ56_26295) | 1792055..1792951 | + | 897 | WP_226220715.1 | VOC family protein | - |
| NTJ56_RS26300 (NTJ56_26300) | 1792961..1793854 | + | 894 | WP_226220714.1 | CoA-transferase | - |
| NTJ56_RS26305 (NTJ56_26305) | 1793865..1794662 | + | 798 | WP_226220713.1 | ketoacid CoA transferase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15342.67 Da Isoelectric Point: 8.5855
>T253728 WP_226220940.1 NZ_CP102483:1789292-1789708 [Burkholderia contaminans]
VYLIDTNIISEIRRGKRTNRGVRAFFRQVAADASPLYLSVVTVAELRRGVDLIRHRGDHAQASALEAWMATILSGYAPNI
LPVDIEISQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVADFARTGVKLLNPFD
VYLIDTNIISEIRRGKRTNRGVRAFFRQVAADASPLYLSVVTVAELRRGVDLIRHRGDHAQASALEAWMATILSGYAPNI
LPVDIEISQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVADFARTGVKLLNPFD
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|