Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1367079..1367734 | Replicon | chromosome |
| Accession | NZ_CP102483 | ||
| Organism | Burkholderia contaminans strain DM32 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | U2HGC0 |
| Locus tag | NTJ56_RS24425 | Protein ID | WP_021158162.1 |
| Coordinates | 1367315..1367734 (+) | Length | 140 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | U2HMP5 |
| Locus tag | NTJ56_RS24420 | Protein ID | WP_021158161.1 |
| Coordinates | 1367079..1367318 (+) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTJ56_RS24400 (NTJ56_24400) | 1362441..1362856 | - | 416 | Protein_1231 | IS5 family transposase | - |
| NTJ56_RS24405 (NTJ56_24405) | 1363062..1363745 | - | 684 | WP_226118815.1 | Fe2+-dependent dioxygenase | - |
| NTJ56_RS24410 (NTJ56_24410) | 1363742..1364521 | - | 780 | WP_226220903.1 | tetratricopeptide repeat protein | - |
| NTJ56_RS24415 (NTJ56_24415) | 1364525..1366768 | - | 2244 | WP_226118813.1 | TonB-dependent siderophore receptor | - |
| NTJ56_RS24420 (NTJ56_24420) | 1367079..1367318 | + | 240 | WP_021158161.1 | antitoxin VapB | Antitoxin |
| NTJ56_RS24425 (NTJ56_24425) | 1367315..1367734 | + | 420 | WP_021158162.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NTJ56_RS24430 (NTJ56_24430) | 1367870..1369165 | - | 1296 | WP_226220902.1 | aspartate carbamoyltransferase | - |
| NTJ56_RS24435 (NTJ56_24435) | 1369399..1369533 | + | 135 | WP_021158165.1 | entericidin A/B family lipoprotein | - |
| NTJ56_RS24440 (NTJ56_24440) | 1369633..1370181 | - | 549 | WP_226118811.1 | permease | - |
| NTJ56_RS24445 (NTJ56_24445) | 1370390..1371358 | - | 969 | WP_226220901.1 | DMT family transporter | - |
| NTJ56_RS24450 (NTJ56_24450) | 1371584..1372378 | - | 795 | WP_226220900.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 1359376..1367734 | 8358 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 140 a.a. Molecular weight: 15212.57 Da Isoelectric Point: 5.9052
>T253726 WP_021158162.1 NZ_CP102483:1367315-1367734 [Burkholderia contaminans]
MILVDTNVISEPLRREPNAAVIEWLDAQNVETLFLAAISLAEIRLGVAVLPEGRRREWLHQSIEQRVLPLFRGRILPFDD
AASKAYASLRARARAAGVAIAPSDGFIAGTAEANGLIVATRDVTPFEAMGIRVIDPWAR
MILVDTNVISEPLRREPNAAVIEWLDAQNVETLFLAAISLAEIRLGVAVLPEGRRREWLHQSIEQRVLPLFRGRILPFDD
AASKAYASLRARARAAGVAIAPSDGFIAGTAEANGLIVATRDVTPFEAMGIRVIDPWAR
Download Length: 420 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|