Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/YoeB-RelB |
| Location | 1277471..1277994 | Replicon | chromosome |
| Accession | NZ_CP102483 | ||
| Organism | Burkholderia contaminans strain DM32 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A2S8ISR8 |
| Locus tag | NTJ56_RS24040 | Protein ID | WP_034180530.1 |
| Coordinates | 1277471..1277737 (-) | Length | 89 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NTJ56_RS24045 | Protein ID | WP_089441963.1 |
| Coordinates | 1277734..1277994 (-) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTJ56_RS24015 (NTJ56_24015) | 1272655..1273893 | - | 1239 | WP_226223756.1 | diaminopimelate decarboxylase | - |
| NTJ56_RS24020 (NTJ56_24020) | 1274003..1274917 | + | 915 | WP_226223755.1 | LysR family transcriptional regulator | - |
| NTJ56_RS24025 (NTJ56_24025) | 1274986..1275585 | + | 600 | WP_226223754.1 | GNAT family protein | - |
| NTJ56_RS24030 (NTJ56_24030) | 1275702..1276280 | - | 579 | WP_226223753.1 | DUF4142 domain-containing protein | - |
| NTJ56_RS24035 (NTJ56_24035) | 1276675..1277298 | - | 624 | WP_039360815.1 | HAD hydrolase-like protein | - |
| NTJ56_RS24040 (NTJ56_24040) | 1277471..1277737 | - | 267 | WP_034180530.1 | Txe/YoeB family addiction module toxin | Toxin |
| NTJ56_RS24045 (NTJ56_24045) | 1277734..1277994 | - | 261 | WP_089441963.1 | type II toxin-antitoxin system prevent-host-death family antitoxin | Antitoxin |
| NTJ56_RS24050 (NTJ56_24050) | 1278218..1278670 | + | 453 | WP_226223751.1 | GNAT family N-acetyltransferase | - |
| NTJ56_RS24055 (NTJ56_24055) | 1278728..1278946 | + | 219 | WP_006480837.1 | DUF1653 domain-containing protein | - |
| NTJ56_RS24060 (NTJ56_24060) | 1278998..1280212 | - | 1215 | WP_226223749.1 | crosslink repair DNA glycosylase YcaQ family protein | - |
| NTJ56_RS24065 (NTJ56_24065) | 1280596..1281984 | - | 1389 | WP_226223747.1 | MFS transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 89 a.a. Molecular weight: 10478.81 Da Isoelectric Point: 7.9861
>T253725 WP_034180530.1 NZ_CP102483:c1277737-1277471 [Burkholderia contaminans]
MSVRRVLVTSDAWDDYVYWQGQDRKTLKRINQLIREAQRTPFEGIGKPEPLKANLSGFWSRRIDDTNRLVYEADDLQISI
VSCRYHYE
MSVRRVLVTSDAWDDYVYWQGQDRKTLKRINQLIREAQRTPFEGIGKPEPLKANLSGFWSRRIDDTNRLVYEADDLQISI
VSCRYHYE
Download Length: 267 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|