Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapB(antitoxin) |
Location | 86747..87330 | Replicon | chromosome |
Accession | NZ_CP102483 | ||
Organism | Burkholderia contaminans strain DM32 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NTJ56_RS18625 | Protein ID | WP_226222489.1 |
Coordinates | 86747..87127 (-) | Length | 127 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | - |
Locus tag | NTJ56_RS18630 | Protein ID | WP_089463371.1 |
Coordinates | 87124..87330 (-) | Length | 69 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NTJ56_RS18605 (NTJ56_18605) | 83062..84141 | - | 1080 | WP_226222491.1 | homoserine dehydrogenase | - |
NTJ56_RS18610 (NTJ56_18610) | 84292..84789 | - | 498 | WP_226117924.1 | Lrp/AsnC family transcriptional regulator | - |
NTJ56_RS18615 (NTJ56_18615) | 84821..85501 | - | 681 | WP_226117926.1 | hypothetical protein | - |
NTJ56_RS18620 (NTJ56_18620) | 85807..86643 | + | 837 | WP_226222490.1 | ion transporter | - |
NTJ56_RS18625 (NTJ56_18625) | 86747..87127 | - | 381 | WP_226222489.1 | VapC toxin family PIN domain ribonuclease | Toxin |
NTJ56_RS18630 (NTJ56_18630) | 87124..87330 | - | 207 | WP_089463371.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NTJ56_RS18635 (NTJ56_18635) | 87455..88123 | - | 669 | WP_226222583.1 | MarC family protein | - |
NTJ56_RS18640 (NTJ56_18640) | 88383..89105 | - | 723 | WP_226222486.1 | arsenical resistance protein ArsH | - |
NTJ56_RS18645 (NTJ56_18645) | 89102..90199 | - | 1098 | WP_226222484.1 | ACR3 family arsenite efflux transporter | - |
NTJ56_RS18650 (NTJ56_18650) | 90264..90755 | - | 492 | WP_226222482.1 | arsenate reductase ArsC | - |
NTJ56_RS18655 (NTJ56_18655) | 90778..91125 | - | 348 | WP_226117934.1 | metalloregulator ArsR/SmtB family transcription factor | - |
NTJ56_RS18660 (NTJ56_18660) | 91228..92214 | - | 987 | WP_226222480.1 | serine protease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 127 a.a. Molecular weight: 13958.25 Da Isoelectric Point: 6.4506
>T253724 WP_226222489.1 NZ_CP102483:c87127-86747 [Burkholderia contaminans]
MNVLIDTSVWVDHFRNRNQTLFGLLALDAVLMHPMVLGELACGTPPAPRLRTLSDLGLLQECNQASMREVMAFVERESLY
GMGYGLVDLTLLASTLITPGARFWTLDRRLAALADRFSVAFRSTSA
MNVLIDTSVWVDHFRNRNQTLFGLLALDAVLMHPMVLGELACGTPPAPRLRTLSDLGLLQECNQASMREVMAFVERESLY
GMGYGLVDLTLLASTLITPGARFWTLDRRLAALADRFSVAFRSTSA
Download Length: 381 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|