Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE(toxin) |
| Location | 3739778..3740231 | Replicon | chromosome |
| Accession | NZ_CP102482 | ||
| Organism | Burkholderia contaminans strain DM32 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NTJ56_RS17835 | Protein ID | WP_196486999.1 |
| Coordinates | 3739778..3740053 (-) | Length | 92 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NTJ56_RS17840 | Protein ID | WP_059890171.1 |
| Coordinates | 3740040..3740231 (-) | Length | 64 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTJ56_RS17815 (NTJ56_17815) | 3737375..3737680 | + | 306 | WP_059890164.1 | hypothetical protein | - |
| NTJ56_RS17820 (NTJ56_17820) | 3737887..3738465 | - | 579 | WP_059890166.1 | ankyrin repeat domain-containing protein | - |
| NTJ56_RS17825 (NTJ56_17825) | 3738611..3738952 | - | 342 | WP_059890167.1 | hypothetical protein | - |
| NTJ56_RS17830 (NTJ56_17830) | 3739009..3739662 | - | 654 | WP_059890169.1 | ParA family protein | - |
| NTJ56_RS17835 (NTJ56_17835) | 3739778..3740053 | - | 276 | WP_196486999.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NTJ56_RS17840 (NTJ56_17840) | 3740040..3740231 | - | 192 | WP_059890171.1 | hypothetical protein | Antitoxin |
| NTJ56_RS17845 (NTJ56_17845) | 3740327..3740713 | - | 387 | WP_059890173.1 | hypothetical protein | - |
| NTJ56_RS17850 (NTJ56_17850) | 3740735..3741052 | - | 318 | WP_059890174.1 | hypothetical protein | - |
| NTJ56_RS17855 (NTJ56_17855) | 3741503..3741937 | - | 435 | WP_059890178.1 | ankyrin repeat domain-containing protein | - |
| NTJ56_RS17860 (NTJ56_17860) | 3742029..3742619 | - | 591 | WP_059890179.1 | hypothetical protein | - |
| NTJ56_RS17865 (NTJ56_17865) | 3742710..3743024 | - | 315 | WP_059890181.1 | hypothetical protein | - |
| NTJ56_RS17870 (NTJ56_17870) | 3743120..3743635 | - | 516 | WP_059890183.1 | ankyrin repeat domain-containing protein | - |
| NTJ56_RS17875 (NTJ56_17875) | 3743819..3744169 | - | 351 | WP_059890184.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | - | 3706950..3762915 | 55965 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 92 a.a. Molecular weight: 10508.16 Da Isoelectric Point: 8.0686
>T253723 WP_196486999.1 NZ_CP102482:c3740053-3739778 [Burkholderia contaminans]
MLPVEWRPRARFRLHKILSDIAELNVFAADDLANDIEQATSNLPAHPYLYRLGRVAGTREIVVHPNYIVIYRVCPAFIEV
VNVVHARQQYP
MLPVEWRPRARFRLHKILSDIAELNVFAADDLANDIEQATSNLPAHPYLYRLGRVAGTREIVVHPNYIVIYRVCPAFIEV
VNVVHARQQYP
Download Length: 276 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|