Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 1968384..1969057 | Replicon | chromosome |
| Accession | NZ_CP102482 | ||
| Organism | Burkholderia contaminans strain DM32 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | U2G353 |
| Locus tag | NTJ56_RS09305 | Protein ID | WP_021160096.1 |
| Coordinates | 1968641..1969057 (+) | Length | 139 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | U2FLJ7 |
| Locus tag | NTJ56_RS09300 | Protein ID | WP_021160097.1 |
| Coordinates | 1968384..1968644 (+) | Length | 87 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NTJ56_RS09285 (NTJ56_09285) | 1963931..1966192 | + | 2262 | WP_226224735.1 | TonB-dependent siderophore receptor | - |
| NTJ56_RS09290 (NTJ56_09290) | 1966279..1967118 | + | 840 | WP_226224738.1 | formyltransferase family protein | - |
| NTJ56_RS09295 (NTJ56_09295) | 1967118..1968134 | + | 1017 | WP_226121616.1 | GNAT family N-acetyltransferase | - |
| NTJ56_RS09300 (NTJ56_09300) | 1968384..1968644 | + | 261 | WP_021160097.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NTJ56_RS09305 (NTJ56_09305) | 1968641..1969057 | + | 417 | WP_021160096.1 | PIN domain-containing protein | Toxin |
| NTJ56_RS09310 (NTJ56_09310) | 1969106..1970011 | - | 906 | WP_226224741.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| NTJ56_RS09315 (NTJ56_09315) | 1969980..1971053 | - | 1074 | WP_226224743.1 | type IV toxin-antitoxin system AbiEi family antitoxin | - |
| NTJ56_RS09320 (NTJ56_09320) | 1971395..1972558 | + | 1164 | WP_226224745.1 | M20 aminoacylase family protein | - |
| NTJ56_RS09325 (NTJ56_09325) | 1972801..1973340 | + | 540 | WP_048020589.1 | outer membrane protein assembly factor BamE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14566.75 Da Isoelectric Point: 7.8895
>T253722 WP_021160096.1 NZ_CP102482:1968641-1969057 [Burkholderia contaminans]
VTTLYMLDTNICSFIMRERPPVVLSRLQSCVNAQHRIVVSAITYAEMRFGAVGRKASPKHAELVTAFVSRLDGVLSWDTA
AVDATAAIRADLAARGMPIGANDASIAGHAIAAGAVLVTNNGREFGRVAGLSLEDWAA
VTTLYMLDTNICSFIMRERPPVVLSRLQSCVNAQHRIVVSAITYAEMRFGAVGRKASPKHAELVTAFVSRLDGVLSWDTA
AVDATAAIRADLAARGMPIGANDASIAGHAIAAGAVLVTNNGREFGRVAGLSLEDWAA
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|