Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
Location | 4577411..4578194 | Replicon | chromosome |
Accession | NZ_CP102479 | ||
Organism | Klebsiella aerogenes strain TS2020 |
Toxin (Protein)
Gene name | yeeV | Uniprot ID | - |
Locus tag | NUT96_RS21715 | Protein ID | WP_249226373.1 |
Coordinates | 4577411..4577779 (-) | Length | 123 a.a. |
Antitoxin (Protein)
Gene name | yeeU | Uniprot ID | - |
Locus tag | NUT96_RS21720 | Protein ID | WP_058914047.1 |
Coordinates | 4577835..4578194 (-) | Length | 120 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUT96_RS21695 (4573025) | 4573025..4573369 | + | 345 | WP_032709754.1 | DUF1294 domain-containing protein | - |
NUT96_RS21700 (4574102) | 4574102..4574959 | - | 858 | WP_257739492.1 | hypothetical protein | - |
NUT96_RS21705 (4574947) | 4574947..4576503 | - | 1557 | WP_257739493.1 | AAA family ATPase | - |
NUT96_RS21710 (4577027) | 4577027..4577269 | - | 243 | WP_257739494.1 | hypothetical protein | - |
NUT96_RS21715 (4577411) | 4577411..4577779 | - | 369 | WP_249226373.1 | TA system toxin CbtA family protein | Toxin |
NUT96_RS21720 (4577835) | 4577835..4578194 | - | 360 | WP_058914047.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
NUT96_RS21725 (4578217) | 4578217..4578438 | - | 222 | WP_058914048.1 | DUF987 domain-containing protein | - |
NUT96_RS21730 (4578452) | 4578452..4578934 | - | 483 | WP_047058008.1 | DNA repair protein RadC | - |
NUT96_RS21735 (4579175) | 4579175..4579654 | - | 480 | Protein_4256 | antirestriction protein | - |
NUT96_RS21740 (4579734) | 4579734..4580555 | - | 822 | WP_071067384.1 | DUF932 domain-containing protein | - |
NUT96_RS21745 (4580666) | 4580666..4580878 | - | 213 | WP_010434180.1 | hypothetical protein | - |
NUT96_RS21750 (4580959) | 4580959..4581318 | - | 360 | WP_010434179.1 | hypothetical protein | - |
NUT96_RS21755 (4581373) | 4581373..4581783 | - | 411 | WP_064355305.1 | hypothetical protein | - |
NUT96_RS21760 (4581891) | 4581891..4582568 | - | 678 | WP_071067386.1 | WYL domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 4574102..4602332 | 28230 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 123 a.a. Molecular weight: 13714.64 Da Isoelectric Point: 9.7929
>T253719 WP_249226373.1 NZ_CP102479:c4577779-4577411 [Klebsiella aerogenes]
IQSLPPQRAASSRLSSVEIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNSILEKYDLVRTDRHGFSV
KEQSPFIGSIDMLRARKATGLMTRKGYKTVTDITSSRFSGRK
IQSLPPQRAASSRLSSVEIWQKLLEYLLEQHYGLTLNDTPFGNDSVIQKHIDAGISLCDAVNSILEKYDLVRTDRHGFSV
KEQSPFIGSIDMLRARKATGLMTRKGYKTVTDITSSRFSGRK
Download Length: 369 bp
Antitoxin
Download Length: 120 a.a. Molecular weight: 13373.45 Da Isoelectric Point: 7.7514
>AT253719 WP_058914047.1 NZ_CP102479:c4578194-4577835 [Klebsiella aerogenes]
MQKATRVINHNIAEPWWGLRRNVTPCFGARLVQEGNRLHYLADRASTTGTFNDTDLRHLDQAFPVLMKQMELMLASSELT
PHIQRCITLHAKGLICEADTLGSCGYLYIVIYPTSAITA
MQKATRVINHNIAEPWWGLRRNVTPCFGARLVQEGNRLHYLADRASTTGTFNDTDLRHLDQAFPVLMKQMELMLASSELT
PHIQRCITLHAKGLICEADTLGSCGYLYIVIYPTSAITA
Download Length: 360 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|