Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 3920305..3920924 | Replicon | chromosome |
Accession | NZ_CP102479 | ||
Organism | Klebsiella aerogenes strain TS2020 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | A0A0H3FXE2 |
Locus tag | NUT96_RS18680 | Protein ID | WP_015367918.1 |
Coordinates | 3920706..3920924 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | A0A0H3FPM3 |
Locus tag | NUT96_RS18675 | Protein ID | WP_015367917.1 |
Coordinates | 3920305..3920679 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUT96_RS18665 (3915463) | 3915463..3916662 | + | 1200 | WP_020079451.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NUT96_RS18670 (3916685) | 3916685..3919831 | + | 3147 | WP_015367916.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NUT96_RS18675 (3920305) | 3920305..3920679 | + | 375 | WP_015367917.1 | Hha toxicity modulator TomB | Antitoxin |
NUT96_RS18680 (3920706) | 3920706..3920924 | + | 219 | WP_015367918.1 | HHA domain-containing protein | Toxin |
NUT96_RS18685 (3921056) | 3921056..3921619 | + | 564 | WP_020079452.1 | maltose O-acetyltransferase | - |
NUT96_RS18690 (3921745) | 3921745..3922209 | + | 465 | WP_015367920.1 | YlaC family protein | - |
NUT96_RS18695 (3922184) | 3922184..3923638 | - | 1455 | WP_045361851.1 | PLP-dependent aminotransferase family protein | - |
NUT96_RS18700 (3923741) | 3923741..3924451 | + | 711 | WP_015704607.1 | GNAT family protein | - |
NUT96_RS18705 (3924448) | 3924448..3924588 | - | 141 | WP_003859006.1 | type B 50S ribosomal protein L36 | - |
NUT96_RS18710 (3924591) | 3924591..3924851 | - | 261 | WP_015367923.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8569.96 Da Isoelectric Point: 9.4828
>T253718 WP_015367918.1 NZ_CP102479:3920706-3920924 [Klebsiella aerogenes]
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSGKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14464.21 Da Isoelectric Point: 4.9045
>AT253718 WP_015367917.1 NZ_CP102479:3920305-3920679 [Klebsiella aerogenes]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNRGWVNDPTSAVNLQLNELIEHIATYALNYKIKYAEDNKLISQLDEYL
DDTFMLFSSYGINTSDLQKWRKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FXE2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3FPM3 |