Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
| Location | 870704..871361 | Replicon | chromosome |
| Accession | NZ_CP102479 | ||
| Organism | Klebsiella aerogenes strain TS2020 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | A0A0H3FM52 |
| Locus tag | NUT96_RS04225 | Protein ID | WP_015369792.1 |
| Coordinates | 870951..871361 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | - |
| Locus tag | NUT96_RS04220 | Protein ID | WP_032709107.1 |
| Coordinates | 870704..870970 (+) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUT96_RS04195 (865931) | 865931..867364 | - | 1434 | WP_032712496.1 | 6-phospho-beta-glucosidase BglA | - |
| NUT96_RS04200 (867484) | 867484..868212 | - | 729 | WP_015369788.1 | MurR/RpiR family transcriptional regulator | - |
| NUT96_RS04205 (868263) | 868263..868574 | + | 312 | WP_058649411.1 | N(4)-acetylcytidine aminohydrolase | - |
| NUT96_RS04210 (868739) | 868739..869398 | + | 660 | WP_008806429.1 | hemolysin III family protein | - |
| NUT96_RS04215 (869497) | 869497..870480 | - | 984 | WP_032709108.1 | tRNA-modifying protein YgfZ | - |
| NUT96_RS04220 (870704) | 870704..870970 | + | 267 | WP_032709107.1 | FAD assembly factor SdhE | Antitoxin |
| NUT96_RS04225 (870951) | 870951..871361 | + | 411 | WP_015369792.1 | protein YgfX | Toxin |
| NUT96_RS04230 (871369) | 871369..871890 | - | 522 | WP_015369793.1 | flavodoxin FldB | - |
| NUT96_RS04235 (871991) | 871991..872887 | + | 897 | WP_015703420.1 | site-specific tyrosine recombinase XerD | - |
| NUT96_RS04240 (872910) | 872910..873623 | + | 714 | WP_015369795.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
| NUT96_RS04245 (873629) | 873629..875362 | + | 1734 | WP_015369796.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15887.69 Da Isoelectric Point: 10.0200
>T253711 WP_015369792.1 NZ_CP102479:870951-871361 [Klebsiella aerogenes]
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
VVLWQSDLRISWRSQWFSLLLHGVVAAIVLLMPWPLSYTPIWLLLLSLVVFDCVRSQRRIHACQGEIKLLIDSRLRWQKT
EWDIVGTPWVISSGMLLRLKHAETGRSQHLWVAADSMDAGEWRDLRRLVLQKPAHD
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|