Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) phd-doc/Doc-RelB
Location 318622..319208 Replicon chromosome
Accession NZ_CP102479
Organism Klebsiella aerogenes strain TS2020

Toxin (Protein)


Gene name doc Uniprot ID -
Locus tag NUT96_RS01510 Protein ID WP_032709318.1
Coordinates 318840..319208 (+) Length 123 a.a.

Antitoxin (Protein)


Gene name phd Uniprot ID W9B1V1
Locus tag NUT96_RS01505 Protein ID WP_004174006.1
Coordinates 318622..318843 (+) Length 74 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUT96_RS01485 (314763) 314763..315689 + 927 WP_015369323.1 high-affinity branched-chain amino acid ABC transporter permease LivH -
NUT96_RS01490 (315686) 315686..316963 + 1278 WP_015369324.1 branched chain amino acid ABC transporter permease LivM -
NUT96_RS01495 (316960) 316960..317727 + 768 WP_032709319.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivG -
NUT96_RS01500 (317745) 317745..318458 + 714 WP_086538103.1 high-affinity branched-chain amino acid ABC transporter ATP-binding protein LivF -
NUT96_RS01505 (318622) 318622..318843 + 222 WP_004174006.1 type II toxin-antitoxin system Phd/YefM family antitoxin Antitoxin
NUT96_RS01510 (318840) 318840..319208 + 369 WP_032709318.1 type II toxin-antitoxin system death-on-curing family toxin Toxin
NUT96_RS01515 (319500) 319500..320816 + 1317 WP_015703703.1 sn-glycerol-3-phosphate ABC transporter substrate-binding protein UgpB -
NUT96_RS01520 (320923) 320923..321810 + 888 WP_015369328.1 sn-glycerol-3-phosphate ABC transporter permease UgpA -
NUT96_RS01525 (321807) 321807..322652 + 846 WP_015369329.1 sn-glycerol-3-phosphate ABC transporter permease UgpE -
NUT96_RS01530 (322654) 322654..323724 + 1071 WP_032709316.1 sn-glycerol-3-phosphate import ATP-binding protein UgpC -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Prophage - - 315686..324461 8775


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Fido domain

(13-86)

Antitoxin

Type II toxin-antitoxin system, antitoxin Phd/YefM

(1-50)


Sequences

Toxin        


Download         Length: 123 a.a.        Molecular weight: 13552.97 Da        Isoelectric Point: 9.7753

>T253710 WP_032709318.1 NZ_CP102479:318840-319208 [Klebsiella aerogenes]
MTLQIISAEEIIQFHDRLLRVTPGVAGMPDPGRAEAIMYRVLNKIEYEGVTDVWRLAAMHLLAISRGHIFNDGNKRTALF
ITLLFLKRNGIILPANPDFVGMTVEAAAGKLTLEQIVARLRG

Download         Length: 369 bp

Antitoxin


Download         Length: 74 a.a.        Molecular weight: 8151.15 Da        Isoelectric Point: 4.7769

>AT253710 WP_004174006.1 NZ_CP102479:318622-318843 [Klebsiella aerogenes]
MRTVNYSEARQNLADVLESAVTGVPVTITRRGHKSAVIISAEEFERYQAARMDDEFAAIMAVHGDEIRELADK

Download         Length: 222 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A5E5YJY7

References