Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1-VagC |
Location | 6391..7040 | Replicon | plasmid unnamed1 |
Accession | NZ_CP102478 | ||
Organism | Burkholderia cenocepacia strain NML110041 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NUJ27_RS36500 | Protein ID | WP_006482112.1 |
Coordinates | 6391..6801 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | B4EQM9 |
Locus tag | NUJ27_RS36505 | Protein ID | WP_006482117.1 |
Coordinates | 6798..7040 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUJ27_RS36480 (NUJ27_36480) | 1917..2432 | - | 516 | WP_227743147.1 | plasmid pRiA4b ORF-3 family protein | - |
NUJ27_RS36485 (NUJ27_36485) | 2976..4781 | - | 1806 | Protein_3 | site-specific integrase | - |
NUJ27_RS36490 (NUJ27_36490) | 5255..5572 | - | 318 | WP_006493600.1 | hypothetical protein | - |
NUJ27_RS36495 (NUJ27_36495) | 5732..6091 | - | 360 | WP_006493602.1 | hypothetical protein | - |
NUJ27_RS36500 (NUJ27_36500) | 6391..6801 | - | 411 | WP_006482112.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUJ27_RS36505 (NUJ27_36505) | 6798..7040 | - | 243 | WP_006482117.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
NUJ27_RS36510 (NUJ27_36510) | 7161..8129 | - | 969 | WP_077176027.1 | non-homologous end-joining DNA ligase | - |
NUJ27_RS36515 (NUJ27_36515) | 8646..9317 | + | 672 | WP_006482119.1 | AAA family ATPase | - |
NUJ27_RS36520 (NUJ27_36520) | 9317..10282 | + | 966 | WP_006482114.1 | ParB/RepB/Spo0J family partition protein | - |
NUJ27_RS36525 (NUJ27_36525) | 11008..11865 | + | 858 | WP_006482109.1 | plasmid replication initiator TrfA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..94494 | 94494 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 14783.04 Da Isoelectric Point: 5.1526
>T253709 WP_006482112.1 NZ_CP102478:c6801-6391 [Burkholderia cenocepacia]
MTLYLLDTNILSNVIRDPRGACATRIGETPPEQVCTSIVVAAELRFGVWKRGSSTLAQRVEQLLASLTVLPLQPDADRCY
GRLRAELEKQGQLIGANDMLIAAHALAVDAVLVTDNTAEFTRVAGLPVENWLRPAT
MTLYLLDTNILSNVIRDPRGACATRIGETPPEQVCTSIVVAAELRFGVWKRGSSTLAQRVEQLLASLTVLPLQPDADRCY
GRLRAELEKQGQLIGANDMLIAAHALAVDAVLVTDNTAEFTRVAGLPVENWLRPAT
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|