Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2590655..2591263 | Replicon | chromosome |
| Accession | NZ_CP102476 | ||
| Organism | Burkholderia cenocepacia strain NML110041 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NUJ27_RS29460 | Protein ID | WP_006490978.1 |
| Coordinates | 2590655..2590960 (+) | Length | 102 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NUJ27_RS29465 | Protein ID | WP_006490972.1 |
| Coordinates | 2590964..2591263 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ27_RS29450 (NUJ27_29450) | 2587164..2588597 | - | 1434 | WP_006490987.1 | aldehyde dehydrogenase family protein | - |
| NUJ27_RS29455 (NUJ27_29455) | 2588626..2590266 | - | 1641 | WP_006490980.1 | acetolactate synthase large subunit | - |
| NUJ27_RS29460 (NUJ27_29460) | 2590655..2590960 | + | 306 | WP_006490978.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUJ27_RS29465 (NUJ27_29465) | 2590964..2591263 | + | 300 | WP_006490972.1 | putative addiction module antidote protein | Antitoxin |
| NUJ27_RS29470 (NUJ27_29470) | 2591312..2592598 | - | 1287 | WP_006490986.1 | DUF445 domain-containing protein | - |
| NUJ27_RS29475 (NUJ27_29475) | 2592695..2593915 | - | 1221 | WP_006490971.1 | anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase | - |
| NUJ27_RS29480 (NUJ27_29480) | 2593905..2594231 | - | 327 | WP_006490973.1 | anthranilate 1,2-dioxygenase ferredoxin subunit AndAb | - |
| NUJ27_RS29485 (NUJ27_29485) | 2594267..2594743 | - | 477 | WP_006490977.1 | anthranilate 1,2-dioxygenase small subunit AndAd | - |
| NUJ27_RS29490 (NUJ27_29490) | 2594759..2596030 | - | 1272 | WP_006490988.1 | anthranilate 1,2-dioxygenase large subunit AndAc | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 102 a.a. Molecular weight: 11270.88 Da Isoelectric Point: 7.2764
>T253708 WP_006490978.1 NZ_CP102476:2590655-2590960 [Burkholderia cenocepacia]
MPYSPPAFSIRTTDVFDAWFAGLPDRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYDVRRGTIWVILLCGGD
KSAQQADIRAAHAMLAHLDME
MPYSPPAFSIRTTDVFDAWFAGLPDRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYDVRRGTIWVILLCGGD
KSAQQADIRAAHAMLAHLDME
Download Length: 306 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|