Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 2185441..2186087 | Replicon | chromosome |
| Accession | NZ_CP102476 | ||
| Organism | Burkholderia cenocepacia strain NML110041 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | B4EGU9 |
| Locus tag | NUJ27_RS27560 | Protein ID | WP_006491144.1 |
| Coordinates | 2185441..2185848 (-) | Length | 136 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | B4EGU8 |
| Locus tag | NUJ27_RS27565 | Protein ID | WP_006491146.1 |
| Coordinates | 2185845..2186087 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ27_RS27540 (NUJ27_27540) | 2181335..2181916 | - | 582 | WP_006486232.1 | hypothetical protein | - |
| NUJ27_RS27545 | 2181913..2182641 | - | 729 | WP_034178465.1 | methyl-accepting chemotaxis protein | - |
| NUJ27_RS27550 (NUJ27_27550) | 2182664..2185039 | - | 2376 | WP_006491138.1 | MCP four helix bundle domain-containing protein | - |
| NUJ27_RS27555 (NUJ27_27555) | 2185097..2185324 | + | 228 | WP_006491154.1 | hypothetical protein | - |
| NUJ27_RS27560 (NUJ27_27560) | 2185441..2185848 | - | 408 | WP_006491144.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUJ27_RS27565 (NUJ27_27565) | 2185845..2186087 | - | 243 | WP_006491146.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NUJ27_RS27570 (NUJ27_27570) | 2186346..2187029 | + | 684 | WP_006491145.1 | phospholipase | - |
| NUJ27_RS27575 (NUJ27_27575) | 2187103..2188608 | - | 1506 | WP_006491141.1 | amino acid permease | - |
| NUJ27_RS27580 (NUJ27_27580) | 2188686..2190092 | - | 1407 | WP_006491136.1 | aspartate ammonia-lyase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 14822.93 Da Isoelectric Point: 6.2165
>T253707 WP_006491144.1 NZ_CP102476:c2185848-2185441 [Burkholderia cenocepacia]
MKFLLDTNAVIAILKGEPAILARLHAWHPADFGIPAIVAHALYYGAYKSQRAAANVARVEALQFEVVSFDTEDAQHAGEI
RAHLIAAGTPIGPYDALIAGQARARQLVLVTHNVREFERVPRLQFEDWLAEPSAD
MKFLLDTNAVIAILKGEPAILARLHAWHPADFGIPAIVAHALYYGAYKSQRAAANVARVEALQFEVVSFDTEDAQHAGEI
RAHLIAAGTPIGPYDALIAGQARARQLVLVTHNVREFERVPRLQFEDWLAEPSAD
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|