Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-StbC |
Location | 1668259..1668898 | Replicon | chromosome |
Accession | NZ_CP102476 | ||
Organism | Burkholderia cenocepacia strain NML110041 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | NUJ27_RS25280 | Protein ID | WP_006481544.1 |
Coordinates | 1668482..1668898 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | A0A364H554 |
Locus tag | NUJ27_RS25275 | Protein ID | WP_006481537.1 |
Coordinates | 1668259..1668495 (+) | Length | 79 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUJ27_RS25260 (NUJ27_25260) | 1664430..1665203 | + | 774 | WP_006481545.1 | SDR family oxidoreductase | - |
NUJ27_RS25265 (NUJ27_25265) | 1665852..1666529 | + | 678 | WP_077176171.1 | hypothetical protein | - |
NUJ27_RS25270 (NUJ27_25270) | 1666540..1667766 | - | 1227 | WP_006481535.1 | acyltransferase | - |
NUJ27_RS25275 (NUJ27_25275) | 1668259..1668495 | + | 237 | WP_006481537.1 | DNA-binding protein | Antitoxin |
NUJ27_RS25280 (NUJ27_25280) | 1668482..1668898 | + | 417 | WP_006481544.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NUJ27_RS25285 (NUJ27_25285) | 1669158..1670054 | + | 897 | WP_006481531.1 | VOC family protein | - |
NUJ27_RS25290 (NUJ27_25290) | 1670064..1670957 | + | 894 | WP_006481548.1 | CoA-transferase | - |
NUJ27_RS25295 (NUJ27_25295) | 1670968..1671765 | + | 798 | WP_006481539.1 | hypothetical protein | - |
NUJ27_RS25300 (NUJ27_25300) | 1671774..1672694 | + | 921 | WP_006481536.1 | enoyl-CoA hydratase | - |
NUJ27_RS25305 (NUJ27_25305) | 1672691..1673791 | + | 1101 | WP_006481534.1 | nitronate monooxygenase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15402.64 Da Isoelectric Point: 6.8818
>T253706 WP_006481544.1 NZ_CP102476:1668482-1668898 [Burkholderia cenocepacia]
VFLIDTNVISEIRKGKRTNRGVRAFFRQAEADASPLYLSVVTVAELRRGVDLIRHRGDHSQASALEAWLTMILSGYAPNI
LPVDVETGQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVDDFARTGVRLLNPFE
VFLIDTNVISEIRKGKRTNRGVRAFFRQAEADASPLYLSVVTVAELRRGVDLIRHRGDHSQASALEAWLTMILSGYAPNI
LPVDVETGQMWGHLRVPDPTHELDKLIAATALINDLTVVTRNVDDFARTGVRLLNPFE
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|