Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/ParE-RHH |
Location | 2245540..2246074 | Replicon | chromosome |
Accession | NZ_CP102475 | ||
Organism | Burkholderia cenocepacia strain NML110041 |
Toxin (Protein)
Gene name | parE | Uniprot ID | - |
Locus tag | NUJ27_RS10715 | Protein ID | WP_021033200.1 |
Coordinates | 2245540..2245839 (-) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | - |
Locus tag | NUJ27_RS10720 | Protein ID | WP_021033199.1 |
Coordinates | 2245829..2246074 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUJ27_RS10695 (NUJ27_10695) | 2242381..2243130 | + | 750 | WP_012492610.1 | uroporphyrinogen-III C-methyltransferase | - |
NUJ27_RS10700 (NUJ27_10700) | 2243127..2243504 | + | 378 | WP_006496449.1 | cobalamin biosynthesis protein | - |
NUJ27_RS10705 (NUJ27_10705) | 2243540..2244142 | + | 603 | WP_006476035.1 | cob(I)yrinic acid a,c-diamide adenosyltransferase | - |
NUJ27_RS10710 (NUJ27_10710) | 2244145..2245449 | + | 1305 | WP_006486048.1 | cobyrinate a,c-diamide synthase | - |
NUJ27_RS10715 (NUJ27_10715) | 2245540..2245839 | - | 300 | WP_021033200.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUJ27_RS10720 (NUJ27_10720) | 2245829..2246074 | - | 246 | WP_021033199.1 | type II toxin-antitoxin system ParD family antitoxin | Antitoxin |
NUJ27_RS10725 (NUJ27_10725) | 2246189..2247352 | - | 1164 | WP_006486051.1 | M20 aminoacylase family protein | - |
NUJ27_RS10730 (NUJ27_10730) | 2247510..2248526 | - | 1017 | WP_006492710.1 | GNAT family N-acetyltransferase | - |
NUJ27_RS10735 (NUJ27_10735) | 2248526..2249365 | - | 840 | WP_006486043.1 | malleobactin biosynthesis enzyme MbaF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11720.37 Da Isoelectric Point: 6.9677
>T253703 WP_021033200.1 NZ_CP102475:c2245839-2245540 [Burkholderia cenocepacia]
MAVKGRQLRLTPLAECDLEDIWRYTAEHWSPEQAEHYYRDLIGTMEALARGKKAGRICVVRDGYFRYPAGSHVVFYRETD
ETIDVIRVLHQRMDIERHL
MAVKGRQLRLTPLAECDLEDIWRYTAEHWSPEQAEHYYRDLIGTMEALARGKKAGRICVVRDGYFRYPAGSHVVFYRETD
ETIDVIRVLHQRMDIERHL
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|