Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 1956150..1956775 | Replicon | chromosome |
| Accession | NZ_CP102473 | ||
| Organism | Burkholderia multivorans strain NML140411 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUJ31_RS24610 | Protein ID | WP_105801348.1 |
| Coordinates | 1956320..1956775 (+) | Length | 152 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NUJ31_RS24605 | Protein ID | WP_176045645.1 |
| Coordinates | 1956150..1956323 (+) | Length | 58 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ31_RS24580 (NUJ31_24580) | 1951232..1951375 | - | 144 | WP_006409932.1 | hypothetical protein | - |
| NUJ31_RS24585 (NUJ31_24585) | 1951964..1952167 | + | 204 | WP_006403067.1 | hypothetical protein | - |
| NUJ31_RS24590 (NUJ31_24590) | 1952181..1952864 | - | 684 | WP_006396647.1 | Fe2+-dependent dioxygenase | - |
| NUJ31_RS24595 (NUJ31_24595) | 1952861..1953616 | - | 756 | WP_006403069.1 | tetratricopeptide repeat protein | - |
| NUJ31_RS24600 (NUJ31_24600) | 1953620..1955866 | - | 2247 | WP_006403070.1 | TonB-dependent siderophore receptor | - |
| NUJ31_RS24605 (NUJ31_24605) | 1956150..1956323 | + | 174 | WP_176045645.1 | plasmid stability protein | Antitoxin |
| NUJ31_RS24610 (NUJ31_24610) | 1956320..1956775 | + | 456 | WP_105801348.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUJ31_RS24615 (NUJ31_24615) | 1956872..1958167 | - | 1296 | WP_035487510.1 | aspartate carbamoyltransferase | - |
| NUJ31_RS24620 (NUJ31_24620) | 1958400..1958534 | + | 135 | WP_006396654.1 | entericidin A/B family lipoprotein | - |
| NUJ31_RS24625 (NUJ31_24625) | 1958628..1959203 | - | 576 | WP_105801347.1 | permease | - |
| NUJ31_RS24630 (NUJ31_24630) | 1959406..1960356 | - | 951 | WP_105801378.1 | DMT family transporter | - |
| NUJ31_RS24635 (NUJ31_24635) | 1960905..1961699 | - | 795 | WP_105848189.1 | AraC family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 152 a.a. Molecular weight: 16110.43 Da Isoelectric Point: 6.4765
>T253701 WP_105801348.1 NZ_CP102473:1956320-1956775 [Burkholderia multivorans]
MILVDTNVISEPLRREPSAAVIEWLDAQNVETLFLAAISLAEMRFGVAALPEGRGRDWLAQSIEHRVVPVFRGRILPFDD
AASKAYARIRAHARAGGNAIAPADGYIAATAEANGLIVATRDVAPFEAAGLRVIDPWASQGAPVRQGIASK
MILVDTNVISEPLRREPSAAVIEWLDAQNVETLFLAAISLAEMRFGVAALPEGRGRDWLAQSIEHRVVPVFRGRILPFDD
AASKAYARIRAHARAGGNAIAPADGYIAATAEANGLIVATRDVAPFEAAGLRVIDPWASQGAPVRQGIASK
Download Length: 456 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|