Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relE-PumB/upstrm_HI1419-dnstrm_HI1420 |
Location | 774100..774720 | Replicon | chromosome |
Accession | NZ_CP102473 | ||
Organism | Burkholderia multivorans strain NML140411 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A0H3KJN2 |
Locus tag | NUJ31_RS19490 | Protein ID | WP_012217495.1 |
Coordinates | 774100..774417 (+) | Length | 106 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | B9B269 |
Locus tag | NUJ31_RS19495 | Protein ID | WP_006398012.1 |
Coordinates | 774421..774720 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NUJ31_RS19480 (NUJ31_19480) | 770633..772066 | - | 1434 | WP_006404214.1 | aldehyde dehydrogenase family protein | - |
NUJ31_RS19485 (NUJ31_19485) | 772095..773735 | - | 1641 | WP_006398015.1 | acetolactate synthase large subunit | - |
NUJ31_RS19490 (NUJ31_19490) | 774100..774417 | + | 318 | WP_012217495.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NUJ31_RS19495 (NUJ31_19495) | 774421..774720 | + | 300 | WP_006398012.1 | putative addiction module antidote protein | Antitoxin |
NUJ31_RS19500 (NUJ31_19500) | 774755..776041 | - | 1287 | WP_053297867.1 | DUF445 domain-containing protein | - |
NUJ31_RS19505 (NUJ31_19505) | 776156..777376 | - | 1221 | WP_105848031.1 | anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase | - |
NUJ31_RS19510 (NUJ31_19510) | 777366..777692 | - | 327 | WP_006404219.1 | anthranilate 1,2-dioxygenase ferredoxin subunit AndAb | - |
NUJ31_RS19515 (NUJ31_19515) | 777710..778198 | - | 489 | WP_006398008.1 | anthranilate 1,2-dioxygenase small subunit AndAd | - |
NUJ31_RS19520 (NUJ31_19520) | 778213..779484 | - | 1272 | WP_217050643.1 | anthranilate 1,2-dioxygenase large subunit AndAc | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 12110.94 Da Isoelectric Point: 10.2349
>T253699 WP_012217495.1 NZ_CP102473:774100-774417 [Burkholderia multivorans]
MPYLAPTFSIRTTAVFDAWFAGLQDRTAKRRIQARIDRLSMGNLGNWKSVGSPVYEMRIDHGPGYRVYFVRRRTIWVVLL
CGGDKSTQRDDIRAAHAMLEHLDLE
MPYLAPTFSIRTTAVFDAWFAGLQDRTAKRRIQARIDRLSMGNLGNWKSVGSPVYEMRIDHGPGYRVYFVRRRTIWVVLL
CGGDKSTQRDDIRAAHAMLEHLDLE
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3KJN2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3KTI5 |