Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/Tad-HTH_37 |
| Location | 2517649..2518349 | Replicon | chromosome |
| Accession | NZ_CP102472 | ||
| Organism | Burkholderia multivorans strain NML140411 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | - |
| Locus tag | NUJ31_RS11825 | Protein ID | WP_217045821.1 |
| Coordinates | 2517649..2518026 (+) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | B9BQB8 |
| Locus tag | NUJ31_RS11830 | Protein ID | WP_006405635.1 |
| Coordinates | 2518026..2518349 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ31_RS11795 (NUJ31_11795) | 2513192..2513638 | + | 447 | WP_217051764.1 | VOC family protein | - |
| NUJ31_RS11800 (NUJ31_11800) | 2513742..2515292 | - | 1551 | WP_006398698.1 | sodium:solute symporter family protein | - |
| NUJ31_RS11805 (NUJ31_11805) | 2515289..2515522 | - | 234 | WP_006398697.1 | DUF3311 domain-containing protein | - |
| NUJ31_RS11810 (NUJ31_11810) | 2515719..2516636 | - | 918 | WP_105774162.1 | spermidine synthase | - |
| NUJ31_RS11815 (NUJ31_11815) | 2516865..2517119 | + | 255 | WP_059940739.1 | hypothetical protein | - |
| NUJ31_RS11820 (NUJ31_11820) | 2517296..2517664 | - | 369 | WP_181146446.1 | hypothetical protein | - |
| NUJ31_RS11825 (NUJ31_11825) | 2517649..2518026 | + | 378 | WP_217045821.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUJ31_RS11830 (NUJ31_11830) | 2518026..2518349 | + | 324 | WP_006405635.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NUJ31_RS11835 (NUJ31_11835) | 2518372..2518863 | - | 492 | WP_070553236.1 | DNA-deoxyinosine glycosylase | - |
| NUJ31_RS11840 (NUJ31_11840) | 2518860..2519474 | - | 615 | WP_217045819.1 | chorismate lyase | - |
| NUJ31_RS11845 (NUJ31_11845) | 2519483..2521381 | - | 1899 | WP_217045817.1 | molecular chaperone HtpG | - |
| NUJ31_RS11850 (NUJ31_11850) | 2521540..2523000 | - | 1461 | WP_006405639.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13557.60 Da Isoelectric Point: 9.7722
>T253698 WP_217045821.1 NZ_CP102472:2517649-2518026 [Burkholderia multivorans]
MGINSSMVPYTKPLYWLGSARKDLKAMPEAVRDTFGYALYLAQTGGKHDQAKPLRGFGSAGVLEVVESEHSGTYRAVYTV
KLGGAVYVLHCFQKKSCRGIATPKPDIELVRARLSAAEAHANGEK
MGINSSMVPYTKPLYWLGSARKDLKAMPEAVRDTFGYALYLAQTGGKHDQAKPLRGFGSAGVLEVVESEHSGTYRAVYTV
KLGGAVYVLHCFQKKSCRGIATPKPDIELVRARLSAAEAHANGEK
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|