Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapC-vagC/VapC-VagC |
| Location | 152627..153264 | Replicon | chromosome |
| Accession | NZ_CP102472 | ||
| Organism | Burkholderia multivorans strain NML140411 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUJ31_RS00670 | Protein ID | WP_217051603.1 |
| Coordinates | 152863..153264 (+) | Length | 134 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | A0A132EWB1 |
| Locus tag | NUJ31_RS00665 | Protein ID | WP_006408845.1 |
| Coordinates | 152627..152863 (+) | Length | 79 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ31_RS00645 (NUJ31_00645) | 147789..148331 | + | 543 | WP_006408276.1 | hypothetical protein | - |
| NUJ31_RS00650 (NUJ31_00650) | 148502..149533 | + | 1032 | WP_105838574.1 | helix-turn-helix domain-containing protein | - |
| NUJ31_RS00655 (NUJ31_00655) | 149652..150740 | - | 1089 | WP_217051604.1 | ADP-heptose--LPS heptosyltransferase | - |
| NUJ31_RS00660 (NUJ31_00660) | 150737..152440 | - | 1704 | WP_105765206.1 | thiamine pyrophosphate-binding protein | - |
| NUJ31_RS00665 (NUJ31_00665) | 152627..152863 | + | 237 | WP_006408845.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NUJ31_RS00670 (NUJ31_00670) | 152863..153264 | + | 402 | WP_217051603.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUJ31_RS00675 (NUJ31_00675) | 153386..154774 | - | 1389 | WP_263074803.1 | L-serine ammonia-lyase | - |
| NUJ31_RS00680 (NUJ31_00680) | 154801..155943 | - | 1143 | WP_006401424.1 | alginate lyase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 134 a.a. Molecular weight: 14956.19 Da Isoelectric Point: 6.2246
>T253697 WP_217051603.1 NZ_CP102472:152863-153264 [Burkholderia multivorans]
MPRYMLDTNMCIYLMKNQPEQVARRFAQCYTGDVVMSAITYAELEYGVTVCANPARERRNLAALIEDIPVAPFDGAAAQA
YGPIREATRERKKDHLDKLIGVHAVSLDVVLVTNHERDFAGYPGLRLENWLVG
MPRYMLDTNMCIYLMKNQPEQVARRFAQCYTGDVVMSAITYAELEYGVTVCANPARERRNLAALIEDIPVAPFDGAAAQA
YGPIREATRERKKDHLDKLIGVHAVSLDVVLVTNHERDFAGYPGLRLENWLVG
Download Length: 402 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|