Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
| Location | 231681..232275 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP102465 | ||
| Organism | Burkholderia contaminans strain NML151013 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | A0A228JB64 |
| Locus tag | NUJ29_RS39420 | Protein ID | WP_027811055.1 |
| Coordinates | 231681..231974 (+) | Length | 98 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A228JAU5 |
| Locus tag | NUJ29_RS39425 | Protein ID | WP_027811056.1 |
| Coordinates | 231976..232275 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ29_RS39395 (NUJ29_39395) | 227064..229274 | + | 2211 | WP_226251535.1 | ParB/RepB/Spo0J family partition protein | - |
| NUJ29_RS39400 (NUJ29_39400) | 230318..230584 | + | 267 | WP_027811052.1 | hypothetical protein | - |
| NUJ29_RS39405 (NUJ29_39405) | 230559..231110 | + | 552 | WP_077186813.1 | hypothetical protein | - |
| NUJ29_RS39410 (NUJ29_39410) | 231155..231376 | + | 222 | WP_027811054.1 | DUF3717 domain-containing protein | - |
| NUJ29_RS39415 (NUJ29_39415) | 231433..231576 | + | 144 | WP_154233621.1 | hypothetical protein | - |
| NUJ29_RS39420 (NUJ29_39420) | 231681..231974 | + | 294 | WP_027811055.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUJ29_RS39425 (NUJ29_39425) | 231976..232275 | + | 300 | WP_027811056.1 | putative addiction module antidote protein | Antitoxin |
| NUJ29_RS39430 (NUJ29_39430) | 232438..232749 | - | 312 | WP_027811057.1 | hypothetical protein | - |
| NUJ29_RS39435 (NUJ29_39435) | 232997..233500 | - | 504 | WP_143277545.1 | hypothetical protein | - |
| NUJ29_RS39440 (NUJ29_39440) | 234517..234918 | + | 402 | WP_027811058.1 | hypothetical protein | - |
| NUJ29_RS39445 (NUJ29_39445) | 234911..236977 | + | 2067 | WP_027811059.1 | type IV secretion system DNA-binding domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..240894 | 240894 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 10854.50 Da Isoelectric Point: 10.6086
>T253696 WP_027811055.1 NZ_CP102465:231681-231974 [Burkholderia contaminans]
MRIEQTDDFAKWLRGLRDHIARAQIAKRIQRLARGQYGDMKPVGAGVSEMRVHVGPGYRVYFVQRGSTLVVLLCGGDKST
QQRDIERAIALSAQLGD
MRIEQTDDFAKWLRGLRDHIARAQIAKRIQRLARGQYGDMKPVGAGVSEMRVHVGPGYRVYFVQRGSTLVVLLCGGDKST
QQRDIERAIALSAQLGD
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A228JB64 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A228JAU5 |