Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/LOTUS_5_Limkain_b1-VagC
Location 66602..67251 Replicon plasmid unnamed1
Accession NZ_CP102465
Organism Burkholderia contaminans strain NML151013

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NUJ29_RS38505 Protein ID WP_027813527.1
Coordinates 66841..67251 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID A0A6P2T8K5
Locus tag NUJ29_RS38500 Protein ID WP_027813526.1
Coordinates 66602..66844 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUJ29_RS38480 (NUJ29_38480) 61819..62676 - 858 WP_027813522.1 plasmid replication initiator TrfA -
NUJ29_RS38485 (NUJ29_38485) 63419..64384 - 966 WP_027813523.1 ParB/RepB/Spo0J family partition protein -
NUJ29_RS38490 (NUJ29_38490) 64384..65055 - 672 WP_027813524.1 AAA family ATPase -
NUJ29_RS38495 (NUJ29_38495) 65521..66507 + 987 WP_223274426.1 non-homologous end-joining DNA ligase -
NUJ29_RS38500 (NUJ29_38500) 66602..66844 + 243 WP_027813526.1 AbrB/MazE/SpoVT family DNA-binding domain-containing protein Antitoxin
NUJ29_RS38505 (NUJ29_38505) 66841..67251 + 411 WP_027813527.1 type II toxin-antitoxin system VapC family toxin Toxin
NUJ29_RS38510 (NUJ29_38510) 67551..67910 + 360 WP_223274427.1 hypothetical protein -
NUJ29_RS38515 (NUJ29_38515) 67959..68159 + 201 WP_034176085.1 hypothetical protein -
NUJ29_RS38520 (NUJ29_38520) 68347..69000 + 654 WP_027813530.1 helix-turn-helix domain-containing protein -
NUJ29_RS38525 (NUJ29_38525) 69021..69326 + 306 WP_027813531.1 hypothetical protein -
NUJ29_RS38530 (NUJ29_38530) 69371..70456 + 1086 WP_027813532.1 hypothetical protein -
NUJ29_RS38535 (NUJ29_38535) 70467..70697 + 231 WP_027813533.1 hypothetical protein -
NUJ29_RS38540 (NUJ29_38540) 70803..71705 + 903 WP_223274428.1 TnsA endonuclease N-terminal domain-containing protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..240894 240894


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(4-124)

Antitoxin

SpoVT-AbrB domain

(12-50)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 14869.13 Da        Isoelectric Point: 4.8604

>T253695 WP_027813527.1 NZ_CP102465:66841-67251 [Burkholderia contaminans]
MTLYLLDTNILSNVIRDPRGACATRIGETPPEQVCTSIIVAAELRFGVWKRGSSTLAQRVEQLLASLTVLPLQPDADRCY
GRLRAELEKQGQLIDANDMLIAAHALAVDAVLVTDNTAEFTRIAGLPVENWLRPAT

Download         Length: 411 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 9375.64 Da        Isoelectric Point: 4.6856

>AT253695 WP_027813526.1 NZ_CP102465:66602-66844 [Burkholderia contaminans]
MPNHDTRHARLFRNGRSQAVRIPREFELPVSEVTIHREGRRLIIEPVEAAPLRELFAQWTPLDEIFPDIEDLPPEPVDIE

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure
AlphaFold DB A0A6P2T8K5

References