Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | chpSB/PRK09812-ChpS |
| Location | 885785..886380 | Replicon | chromosome |
| Accession | NZ_CP102464 | ||
| Organism | Burkholderia contaminans strain NML151013 | ||
Toxin (Protein)
| Gene name | chpB | Uniprot ID | - |
| Locus tag | NUJ29_RS36090 | Protein ID | WP_105817739.1 |
| Coordinates | 885785..886135 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | chpS | Uniprot ID | A0A0G3Z282 |
| Locus tag | NUJ29_RS36095 | Protein ID | WP_039362633.1 |
| Coordinates | 886129..886380 (-) | Length | 84 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ29_RS36080 (NUJ29_36080) | 882622..884094 | + | 1473 | WP_105817741.1 | efflux RND transporter periplasmic adaptor subunit | - |
| NUJ29_RS36085 (NUJ29_36085) | 884126..885661 | + | 1536 | WP_105817740.1 | efflux transporter outer membrane subunit | - |
| NUJ29_RS36090 (NUJ29_36090) | 885785..886135 | - | 351 | WP_105817739.1 | type II toxin-antitoxin system ChpB family toxin | Toxin |
| NUJ29_RS36095 (NUJ29_36095) | 886129..886380 | - | 252 | WP_039362633.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NUJ29_RS36100 (NUJ29_36100) | 886548..886709 | - | 162 | Protein_765 | tyrosine-type recombinase/integrase | - |
| NUJ29_RS36105 (NUJ29_36105) | 886747..887178 | + | 432 | Protein_766 | hypothetical protein | - |
| NUJ29_RS36110 (NUJ29_36110) | 887366..889186 | + | 1821 | WP_105817738.1 | asparagine synthase (glutamine-hydrolyzing) | - |
| NUJ29_RS36115 (NUJ29_36115) | 889421..890881 | - | 1461 | WP_105817737.1 | heavy metal sensor histidine kinase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12373.27 Da Isoelectric Point: 10.0752
>T253694 WP_105817739.1 NZ_CP102464:c886135-885785 [Burkholderia contaminans]
MVRRVKFERGDIVRVSLNPTVGKEQQGDFRPALVLSPAAFNALGVALVAPIAQGGEFARYAGFAVPLSGSGTETQGVALV
NMVRTLDLQARGARKVERAPSEVIEDALARLQTILE
MVRRVKFERGDIVRVSLNPTVGKEQQGDFRPALVLSPAAFNALGVALVAPIAQGGEFARYAGFAVPLSGSGTETQGVALV
NMVRTLDLQARGARKVERAPSEVIEDALARLQTILE
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|