Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/PIN-MazE |
| Location | 2833196..2833829 | Replicon | chromosome |
| Accession | NZ_CP102463 | ||
| Organism | Burkholderia contaminans strain NML151013 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUJ29_RS30825 | Protein ID | WP_105815256.1 |
| Coordinates | 2833416..2833829 (+) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A2S9P9A2 |
| Locus tag | NUJ29_RS30820 | Protein ID | WP_071333622.1 |
| Coordinates | 2833196..2833429 (+) | Length | 78 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ29_RS30805 (NUJ29_30805) | 2828219..2829913 | + | 1695 | WP_105815258.1 | VRR-NUC domain-containing protein | - |
| NUJ29_RS30810 (NUJ29_30810) | 2829910..2832210 | + | 2301 | WP_105815257.1 | ATP-dependent DNA helicase | - |
| NUJ29_RS30815 (NUJ29_30815) | 2832259..2833029 | - | 771 | WP_039367494.1 | IclR family transcriptional regulator C-terminal domain-containing protein | - |
| NUJ29_RS30820 (NUJ29_30820) | 2833196..2833429 | + | 234 | WP_071333622.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NUJ29_RS30825 (NUJ29_30825) | 2833416..2833829 | + | 414 | WP_105815256.1 | PIN domain-containing protein | Toxin |
| NUJ29_RS30830 (NUJ29_30830) | 2833979..2834392 | - | 414 | WP_105815255.1 | hypothetical protein | - |
| NUJ29_RS30835 (NUJ29_30835) | 2834664..2835275 | + | 612 | WP_105815254.1 | hypothetical protein | - |
| NUJ29_RS30840 (NUJ29_30840) | 2835347..2836648 | - | 1302 | WP_039367440.1 | UDP-N-acetylglucosamine 1-carboxyvinyltransferase | - |
| NUJ29_RS30845 (NUJ29_30845) | 2836866..2838170 | - | 1305 | WP_105815253.1 | shikimate transporter | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 15208.44 Da Isoelectric Point: 4.7627
>T253692 WP_105815256.1 NZ_CP102463:2833416-2833829 [Burkholderia contaminans]
MSGIDATKSFVDSNVVLYLLSEDETKADRAESLLLRRPTISVQVLNEVASVCSRKLRMPWFDVGQFLEPIRSLCRVVPIS
VDTHDLGRKLAERHGLSFYDACIVASATIEGCEYLYTEDMHDGLCVEGGPVLKNPFA
MSGIDATKSFVDSNVVLYLLSEDETKADRAESLLLRRPTISVQVLNEVASVCSRKLRMPWFDVGQFLEPIRSLCRVVPIS
VDTHDLGRKLAERHGLSFYDACIVASATIEGCEYLYTEDMHDGLCVEGGPVLKNPFA
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|