Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2104574..2105194 | Replicon | chromosome |
| Accession | NZ_CP102463 | ||
| Organism | Burkholderia contaminans strain NML151013 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NUJ29_RS27610 | Protein ID | WP_249362359.1 |
| Coordinates | 2104877..2105194 (-) | Length | 106 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | A0A1J9PWC2 |
| Locus tag | NUJ29_RS27605 | Protein ID | WP_039344756.1 |
| Coordinates | 2104574..2104873 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ29_RS27580 (NUJ29_27580) | 2099737..2101008 | + | 1272 | WP_105818955.1 | anthranilate 1,2-dioxygenase large subunit AndAc | - |
| NUJ29_RS27585 (NUJ29_27585) | 2101023..2101511 | + | 489 | WP_011355917.1 | anthranilate 1,2-dioxygenase small subunit AndAd | - |
| NUJ29_RS27590 (NUJ29_27590) | 2101532..2101858 | + | 327 | WP_039344765.1 | anthranilate 1,2-dioxygenase ferredoxin subunit AndAb | - |
| NUJ29_RS27595 (NUJ29_27595) | 2101848..2103068 | + | 1221 | WP_105818954.1 | anthranilate 1,2-dioxygenase system ferredoxin--NAD(+) reductase | - |
| NUJ29_RS27600 (NUJ29_27600) | 2103239..2104525 | + | 1287 | WP_105818953.1 | DUF445 domain-containing protein | - |
| NUJ29_RS27605 (NUJ29_27605) | 2104574..2104873 | - | 300 | WP_039344756.1 | putative addiction module antidote protein | Antitoxin |
| NUJ29_RS27610 (NUJ29_27610) | 2104877..2105194 | - | 318 | WP_249362359.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUJ29_RS27615 (NUJ29_27615) | 2105547..2107187 | + | 1641 | WP_105818951.1 | acetolactate synthase large subunit | - |
| NUJ29_RS27620 (NUJ29_27620) | 2107217..2108650 | + | 1434 | WP_105818950.1 | aldehyde dehydrogenase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 106 a.a. Molecular weight: 11854.57 Da Isoelectric Point: 9.5691
>T253691 WP_249362359.1 NZ_CP102463:c2105194-2104877 [Burkholderia contaminans]
MPYSAPTFSIRTTDVFDTWFAGLQDRVAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILL
CGGDKSSQQADIRAAHAMLAHLDME
MPYSAPTFSIRTTDVFDTWFAGLQDRVAKRRIQARIDRLSMGNPGDWKSAGSPVVEMRIDHGPGYRVYYVRRGTIWVILL
CGGDKSSQQADIRAAHAMLAHLDME
Download Length: 318 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|