Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tad-ata/Tad-HTH_37 |
| Location | 2930579..2931261 | Replicon | chromosome |
| Accession | NZ_CP102462 | ||
| Organism | Burkholderia contaminans strain NML151013 | ||
Toxin (Protein)
| Gene name | tad | Uniprot ID | A0A6P2YP52 |
| Locus tag | NUJ29_RS13845 | Protein ID | WP_046544690.1 |
| Coordinates | 2930579..2930941 (+) | Length | 121 a.a. |
Antitoxin (Protein)
| Gene name | ata | Uniprot ID | - |
| Locus tag | NUJ29_RS13850 | Protein ID | WP_046544689.1 |
| Coordinates | 2930938..2931261 (+) | Length | 108 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ29_RS13820 (NUJ29_13820) | 2926402..2926857 | + | 456 | WP_105818698.1 | VOC family protein | - |
| NUJ29_RS13825 (NUJ29_13825) | 2926925..2928475 | - | 1551 | WP_039370375.1 | sodium:solute symporter family protein | - |
| NUJ29_RS13830 (NUJ29_13830) | 2928472..2928714 | - | 243 | WP_011352801.1 | DUF3311 domain-containing protein | - |
| NUJ29_RS13835 (NUJ29_13835) | 2928913..2929830 | - | 918 | WP_105818697.1 | spermidine synthase | - |
| NUJ29_RS13840 (NUJ29_13840) | 2929975..2930229 | + | 255 | WP_071334800.1 | hypothetical protein | - |
| NUJ29_RS13845 (NUJ29_13845) | 2930579..2930941 | + | 363 | WP_046544690.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUJ29_RS13850 (NUJ29_13850) | 2930938..2931261 | + | 324 | WP_046544689.1 | helix-turn-helix transcriptional regulator | Antitoxin |
| NUJ29_RS13855 (NUJ29_13855) | 2931323..2931799 | - | 477 | WP_105818696.1 | DNA-deoxyinosine glycosylase | - |
| NUJ29_RS13860 (NUJ29_13860) | 2931799..2932395 | - | 597 | WP_039370667.1 | chorismate lyase | - |
| NUJ29_RS13865 (NUJ29_13865) | 2932404..2934302 | - | 1899 | WP_047852434.1 | molecular chaperone HtpG | - |
| NUJ29_RS13870 (NUJ29_13870) | 2934461..2935921 | - | 1461 | WP_039370360.1 | PLP-dependent aminotransferase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 121 a.a. Molecular weight: 13299.24 Da Isoelectric Point: 9.9311
>T253688 WP_046544690.1 NZ_CP102462:2930579-2930941 [Burkholderia contaminans]
MDPYIKPLYWLGSARKDLKAMPQAVQDTFGYALYLAQTGRKHDQAKPLKGFGSAGVLEIVESEDNGTYRAVYTVKLGSSV
YVLHCFQKKSSIGIATPRPDSDLVRERLKAAEAHAQGVRR
MDPYIKPLYWLGSARKDLKAMPQAVQDTFGYALYLAQTGRKHDQAKPLKGFGSAGVLEIVESEDNGTYRAVYTVKLGSSV
YVLHCFQKKSSIGIATPRPDSDLVRERLKAAEAHAQGVRR
Download Length: 363 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|