Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-StbC |
| Location | 369873..370564 | Replicon | chromosome |
| Accession | NZ_CP102459 | ||
| Organism | Burkholderia multivorans strain NML180963 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NUJ28_RS18450 | Protein ID | WP_059874917.1 |
| Coordinates | 369873..370328 (-) | Length | 152 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | A0A2S9M8Q6 |
| Locus tag | NUJ28_RS18455 | Protein ID | WP_059874916.1 |
| Coordinates | 370325..370564 (-) | Length | 80 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ28_RS18425 (NUJ28_18425) | 364972..365766 | + | 795 | WP_105821753.1 | AraC family transcriptional regulator | - |
| NUJ28_RS18430 (NUJ28_18430) | 366281..367231 | + | 951 | WP_105822030.1 | DMT family transporter | - |
| NUJ28_RS18435 (NUJ28_18435) | 367442..368017 | + | 576 | WP_105821977.1 | permease | - |
| NUJ28_RS18440 (NUJ28_18440) | 368113..368247 | - | 135 | WP_006396654.1 | entericidin A/B family lipoprotein | - |
| NUJ28_RS18445 (NUJ28_18445) | 368480..369775 | + | 1296 | WP_035487510.1 | aspartate carbamoyltransferase | - |
| NUJ28_RS18450 (NUJ28_18450) | 369873..370328 | - | 456 | WP_059874917.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUJ28_RS18455 (NUJ28_18455) | 370325..370564 | - | 240 | WP_059874916.1 | Arc family DNA-binding protein | Antitoxin |
| NUJ28_RS18460 (NUJ28_18460) | 370869..373115 | + | 2247 | WP_176035228.1 | TonB-dependent siderophore receptor | - |
| NUJ28_RS18465 (NUJ28_18465) | 373119..373874 | + | 756 | WP_105821978.1 | tetratricopeptide repeat protein | - |
| NUJ28_RS18470 (NUJ28_18470) | 373871..374554 | + | 684 | WP_035955277.1 | Fe2+-dependent dioxygenase | - |
| NUJ28_RS18475 (NUJ28_18475) | 374960..375199 | + | 240 | WP_006416205.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 152 a.a. Molecular weight: 16251.60 Da Isoelectric Point: 6.4793
>T253683 WP_059874917.1 NZ_CP102459:c370328-369873 [Burkholderia multivorans]
MILVDTNVIAEPLRREPSAAVIEWLDAQNVETLFLAAISLAEMRFGVAALPEGRRRDWLEQSIEHRVVPVFRGRILPFDD
AASKAYARIRAHARAGGNAIAPADGYIAATAEANGLIVATRDVAPFEAAGLRVIDPWASQGAPVRQGIASK
MILVDTNVIAEPLRREPSAAVIEWLDAQNVETLFLAAISLAEMRFGVAALPEGRRRDWLEQSIEHRVVPVFRGRILPFDD
AASKAYARIRAHARAGGNAIAPADGYIAATAEANGLIVATRDVAPFEAAGLRVIDPWASQGAPVRQGIASK
Download Length: 456 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|