Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/upstrm_HI1419-dnstrm_HI1420 |
| Location | 2594349..2594959 | Replicon | chromosome |
| Accession | NZ_CP102458 | ||
| Organism | Burkholderia multivorans strain NML180963 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | NUJ28_RS12610 | Protein ID | WP_176034435.1 |
| Coordinates | 2594651..2594959 (-) | Length | 103 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | - |
| Locus tag | NUJ28_RS12605 | Protein ID | WP_176034436.1 |
| Coordinates | 2594349..2594654 (-) | Length | 102 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ28_RS12570 (NUJ28_12570) | 2590203..2590682 | - | 480 | WP_176034440.1 | hypothetical protein | - |
| NUJ28_RS12575 (NUJ28_12575) | 2591205..2591513 | - | 309 | WP_261531626.1 | integrase domain-containing protein | - |
| NUJ28_RS12580 (NUJ28_12580) | 2591413..2591766 | - | 354 | WP_261531627.1 | integrase domain-containing protein | - |
| NUJ28_RS12585 (NUJ28_12585) | 2591994..2592251 | - | 258 | WP_176034439.1 | hypothetical protein | - |
| NUJ28_RS12590 (NUJ28_12590) | 2592202..2592526 | - | 325 | Protein_2451 | SOS response-associated peptidase | - |
| NUJ28_RS12595 (NUJ28_12595) | 2592643..2593116 | - | 474 | WP_176034438.1 | hypothetical protein | - |
| NUJ28_RS12600 (NUJ28_12600) | 2593113..2594003 | - | 891 | WP_176034437.1 | endonuclease/exonuclease/phosphatase family protein | - |
| NUJ28_RS12605 (NUJ28_12605) | 2594349..2594654 | - | 306 | WP_176034436.1 | putative addiction module antidote protein | Antitoxin |
| NUJ28_RS12610 (NUJ28_12610) | 2594651..2594959 | - | 309 | WP_176034435.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NUJ28_RS12615 (NUJ28_12615) | 2595631..2595876 | + | 246 | WP_006398667.1 | hypothetical protein | - |
| NUJ28_RS12620 (NUJ28_12620) | 2595899..2596669 | - | 771 | WP_176034434.1 | SDR family oxidoreductase | - |
| NUJ28_RS12625 (NUJ28_12625) | 2596831..2598858 | + | 2028 | WP_263130135.1 | protein-L-isoaspartate(D-aspartate) O-methyltransferase | - |
| NUJ28_RS12630 (NUJ28_12630) | 2598985..2599725 | - | 741 | WP_176034432.1 | SDR family NAD(P)-dependent oxidoreductase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 2574004..2594959 | 20955 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 103 a.a. Molecular weight: 11639.13 Da Isoelectric Point: 8.9317
>T253681 WP_176034435.1 NZ_CP102458:c2594959-2594651 [Burkholderia multivorans]
MNTINQTGEFQEWLRDLKDKVGRGAILGRINRARLGNFGDHKDLGDGVSEMRIDVGPGYRVYFGRDGKDIYLLICGGDKS
SQDKDIKHAKAIWEQFRKEQQP
MNTINQTGEFQEWLRDLKDKVGRGAILGRINRARLGNFGDHKDLGDGVSEMRIDVGPGYRVYFGRDGKDIYLLICGGDKS
SQDKDIKHAKAIWEQFRKEQQP
Download Length: 309 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|