Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vapBC/VapC-VagC
Location 1876017..1876669 Replicon chromosome
Accession NZ_CP102441
Organism Pseudomonas aeruginosa strain PA30

Toxin (Protein)


Gene name vapC Uniprot ID -
Locus tag NR803_RS08930 Protein ID WP_003134109.1
Coordinates 1876259..1876669 (+) Length 137 a.a.

Antitoxin (Protein)


Gene name vapB Uniprot ID -
Locus tag NR803_RS08925 Protein ID WP_170869361.1
Coordinates 1876017..1876259 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR803_RS08910 (NR803_08915) 1871025..1872914 - 1890 WP_191519263.1 hypothetical protein -
NR803_RS08915 (NR803_08920) 1873026..1873772 - 747 WP_223723588.1 hypothetical protein -
NR803_RS08920 (NR803_08925) 1873786..1875711 - 1926 WP_191519261.1 type I DNA topoisomerase -
NR803_RS08925 (NR803_08930) 1876017..1876259 + 243 WP_170869361.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NR803_RS08930 (NR803_08935) 1876259..1876669 + 411 WP_003134109.1 tRNA(fMet)-specific endonuclease VapC Toxin
NR803_RS08935 (NR803_08940) 1876685..1876846 + 162 WP_191519260.1 hypothetical protein -
NR803_RS08940 (NR803_08945) 1876896..1877114 + 219 WP_023083218.1 hypothetical protein -
NR803_RS08945 (NR803_08950) 1877180..1877377 - 198 WP_191519259.1 CrpP family ICE-associated protein -
NR803_RS08950 (NR803_08955) 1877876..1878364 - 489 WP_023104904.1 single-stranded DNA-binding protein -
NR803_RS08955 (NR803_08960) 1878378..1878908 - 531 WP_121372660.1 DUF3158 family protein -
NR803_RS08960 (NR803_08965) 1878914..1879642 - 729 WP_009315862.1 TIGR03761 family integrating conjugative element protein -
NR803_RS08965 (NR803_08970) 1879799..1880311 - 513 WP_223697281.1 hypothetical protein -
NR803_RS08970 (NR803_08975) 1880308..1881633 - 1326 WP_191519258.1 STY4528 family pathogenicity island replication protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Integrative and Conjugative Element - katA 1768284..1895132 126848


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-124)

Antitoxin

SpoVT-AbrB domain

(11-37)


Sequences

Toxin        


Download         Length: 137 a.a.        Molecular weight: 15452.78 Da        Isoelectric Point: 7.3233

>T253674 WP_003134109.1 NZ_CP102441:1876259-1876669 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV

Download         Length: 411 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8909.94 Da        Isoelectric Point: 4.4230

>AT253674 WP_170869361.1 NZ_CP102441:1876017-1876259 [Pseudomonas aeruginosa]
MRCVVEQGSVFQSNRSQAVRLPKAVALPDDVKRVDVVAVGRARIITPAGESWDSWFDGEGVTADFMAEREQPADQERETF

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References