Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 1876017..1876669 | Replicon | chromosome |
| Accession | NZ_CP102441 | ||
| Organism | Pseudomonas aeruginosa strain PA30 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NR803_RS08930 | Protein ID | WP_003134109.1 |
| Coordinates | 1876259..1876669 (+) | Length | 137 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NR803_RS08925 | Protein ID | WP_170869361.1 |
| Coordinates | 1876017..1876259 (+) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR803_RS08910 (NR803_08915) | 1871025..1872914 | - | 1890 | WP_191519263.1 | hypothetical protein | - |
| NR803_RS08915 (NR803_08920) | 1873026..1873772 | - | 747 | WP_223723588.1 | hypothetical protein | - |
| NR803_RS08920 (NR803_08925) | 1873786..1875711 | - | 1926 | WP_191519261.1 | type I DNA topoisomerase | - |
| NR803_RS08925 (NR803_08930) | 1876017..1876259 | + | 243 | WP_170869361.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NR803_RS08930 (NR803_08935) | 1876259..1876669 | + | 411 | WP_003134109.1 | tRNA(fMet)-specific endonuclease VapC | Toxin |
| NR803_RS08935 (NR803_08940) | 1876685..1876846 | + | 162 | WP_191519260.1 | hypothetical protein | - |
| NR803_RS08940 (NR803_08945) | 1876896..1877114 | + | 219 | WP_023083218.1 | hypothetical protein | - |
| NR803_RS08945 (NR803_08950) | 1877180..1877377 | - | 198 | WP_191519259.1 | CrpP family ICE-associated protein | - |
| NR803_RS08950 (NR803_08955) | 1877876..1878364 | - | 489 | WP_023104904.1 | single-stranded DNA-binding protein | - |
| NR803_RS08955 (NR803_08960) | 1878378..1878908 | - | 531 | WP_121372660.1 | DUF3158 family protein | - |
| NR803_RS08960 (NR803_08965) | 1878914..1879642 | - | 729 | WP_009315862.1 | TIGR03761 family integrating conjugative element protein | - |
| NR803_RS08965 (NR803_08970) | 1879799..1880311 | - | 513 | WP_223697281.1 | hypothetical protein | - |
| NR803_RS08970 (NR803_08975) | 1880308..1881633 | - | 1326 | WP_191519258.1 | STY4528 family pathogenicity island replication protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Integrative and Conjugative Element | - | katA | 1768284..1895132 | 126848 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15452.78 Da Isoelectric Point: 7.3233
>T253674 WP_003134109.1 NZ_CP102441:1876259-1876669 [Pseudomonas aeruginosa]
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
MLKFMLDTNICIFTIKNRPQEVREAFLRHHDQMCISTVTLMELIYGAEKSSNPSRNLADVEGFAARLEVLKYDQEAAAHT
GQLRAELARLGKQIGPYDQMIAGHARSQGLIVVTNNRREFDRVPGLRVEDWVTPIV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|