Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 1017397..1017983 | Replicon | chromosome |
Accession | NZ_CP102441 | ||
Organism | Pseudomonas aeruginosa strain PA30 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | G8CP73 |
Locus tag | NR803_RS04915 | Protein ID | WP_003120987.1 |
Coordinates | 1017397..1017696 (+) | Length | 100 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | NR803_RS04920 | Protein ID | WP_003448662.1 |
Coordinates | 1017693..1017983 (+) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR803_RS04895 (NR803_04895) | 1012510..1013043 | - | 534 | WP_003099760.1 | type IV pilus biogenesis protein PilP | - |
NR803_RS04900 (NR803_04900) | 1013033..1014358 | - | 1326 | WP_003099758.1 | type 4b pilus protein PilO2 | - |
NR803_RS04905 (NR803_04905) | 1014362..1016071 | - | 1710 | WP_003099757.1 | PilN family type IVB pilus formation outer membrane protein | - |
NR803_RS04910 (NR803_04910) | 1016071..1017195 | - | 1125 | WP_012076859.1 | TcpQ domain-containing protein | - |
NR803_RS04915 (NR803_04915) | 1017397..1017696 | + | 300 | WP_003120987.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NR803_RS04920 (NR803_04920) | 1017693..1017983 | + | 291 | WP_003448662.1 | putative addiction module antidote protein | Antitoxin |
NR803_RS04925 (NR803_04925) | 1018054..1018398 | - | 345 | WP_016851612.1 | hypothetical protein | - |
NR803_RS04930 (NR803_04930) | 1018395..1018529 | - | 135 | WP_255253641.1 | hypothetical protein | - |
NR803_RS04935 (NR803_04935) | 1018539..1020515 | - | 1977 | WP_016851611.1 | DEAD/DEAH box helicase | - |
NR803_RS04940 (NR803_04940) | 1020512..1022401 | - | 1890 | WP_196994395.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Integrative and Conjugative Element | - | - | 958800..1046012 | 87212 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 100 a.a. Molecular weight: 11133.88 Da Isoelectric Point: 10.4495
>T253673 WP_003120987.1 NZ_CP102441:1017397-1017696 [Pseudomonas aeruginosa]
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
MVEVKQTATFMAWESKLKDRRAKAVIAARIFRLANGLPGDVSPVGQGVSELRIHYGPGYRVYFQQRGTEIVILLCGGDKS
SQARDIEMAKRLANEWRPQ
Download Length: 300 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|