Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 176844..177514 Replicon plasmid unnamed1
Accession NZ_CP102439
Organism Klebsiella pneumoniae strain hvKP248

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NUJ53_RS26750 Protein ID WP_004213072.1
Coordinates 176844..177287 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NUJ53_RS26755 Protein ID WP_004213073.1
Coordinates 177284..177514 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUJ53_RS26715 (NUJ53_26715) 172276..172551 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NUJ53_RS26720 (NUJ53_26720) 172614..173105 + 492 WP_011251327.1 DM13 domain-containing protein -
NUJ53_RS26725 (NUJ53_26725) 173154..174074 + 921 WP_029884592.1 DUF1471 domain-containing protein -
NUJ53_RS26730 (NUJ53_26730) 174165..174568 + 404 Protein_193 GAF domain-containing protein -
NUJ53_RS26735 (NUJ53_26735) 175087..175722 - 636 Protein_194 mucoid phenotype regulator RmpA2 -
NUJ53_RS26740 (NUJ53_26740) 176117..176421 + 305 Protein_195 transposase -
NUJ53_RS26745 (NUJ53_26745) 176444..176695 - 252 WP_186987481.1 hypothetical protein -
NUJ53_RS26750 (NUJ53_26750) 176844..177287 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NUJ53_RS26755 (NUJ53_26755) 177284..177514 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NUJ53_RS26760 (NUJ53_26760) 178122..179255 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NUJ53_RS26765 (NUJ53_26765) 179271..179564 + 294 WP_004213076.1 hypothetical protein -
NUJ53_RS26770 (NUJ53_26770) 179554..179760 - 207 WP_004213077.1 hypothetical protein -
NUJ53_RS26775 (NUJ53_26775) 180112..180402 + 291 WP_004213078.1 hypothetical protein -
NUJ53_RS26780 (NUJ53_26780) 180392..181291 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA2 1..235915 235915


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T253669 WP_004213072.1 NZ_CP102439:c177287-176844 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT253669 WP_004213073.1 NZ_CP102439:c177514-177284 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References