Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vagCD/VapC-VagC |
| Location | 176844..177514 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP102439 | ||
| Organism | Klebsiella pneumoniae strain hvKP248 | ||
Toxin (Protein)
| Gene name | vagD | Uniprot ID | Q6U619 |
| Locus tag | NUJ53_RS26750 | Protein ID | WP_004213072.1 |
| Coordinates | 176844..177287 (-) | Length | 148 a.a. |
Antitoxin (Protein)
| Gene name | vagC | Uniprot ID | Q6U620 |
| Locus tag | NUJ53_RS26755 | Protein ID | WP_004213073.1 |
| Coordinates | 177284..177514 (-) | Length | 77 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ53_RS26715 (NUJ53_26715) | 172276..172551 | + | 276 | WP_004213932.1 | carboxymuconolactone decarboxylase family protein | - |
| NUJ53_RS26720 (NUJ53_26720) | 172614..173105 | + | 492 | WP_011251327.1 | DM13 domain-containing protein | - |
| NUJ53_RS26725 (NUJ53_26725) | 173154..174074 | + | 921 | WP_029884592.1 | DUF1471 domain-containing protein | - |
| NUJ53_RS26730 (NUJ53_26730) | 174165..174568 | + | 404 | Protein_193 | GAF domain-containing protein | - |
| NUJ53_RS26735 (NUJ53_26735) | 175087..175722 | - | 636 | Protein_194 | mucoid phenotype regulator RmpA2 | - |
| NUJ53_RS26740 (NUJ53_26740) | 176117..176421 | + | 305 | Protein_195 | transposase | - |
| NUJ53_RS26745 (NUJ53_26745) | 176444..176695 | - | 252 | WP_186987481.1 | hypothetical protein | - |
| NUJ53_RS26750 (NUJ53_26750) | 176844..177287 | - | 444 | WP_004213072.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NUJ53_RS26755 (NUJ53_26755) | 177284..177514 | - | 231 | WP_004213073.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
| NUJ53_RS26760 (NUJ53_26760) | 178122..179255 | + | 1134 | WP_004213075.1 | DUF3800 domain-containing protein | - |
| NUJ53_RS26765 (NUJ53_26765) | 179271..179564 | + | 294 | WP_004213076.1 | hypothetical protein | - |
| NUJ53_RS26770 (NUJ53_26770) | 179554..179760 | - | 207 | WP_004213077.1 | hypothetical protein | - |
| NUJ53_RS26775 (NUJ53_26775) | 180112..180402 | + | 291 | WP_004213078.1 | hypothetical protein | - |
| NUJ53_RS26780 (NUJ53_26780) | 180392..181291 | + | 900 | WP_004225022.1 | nucleotide-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..235915 | 235915 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 148 a.a. Molecular weight: 16006.74 Da Isoelectric Point: 9.3642
>T253669 WP_004213072.1 NZ_CP102439:c177287-176844 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS
Download Length: 444 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|