Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
| Location | 111348..112084 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP102439 | ||
| Organism | Klebsiella pneumoniae strain hvKP248 | ||
Toxin (Protein)
| Gene name | tacT | Uniprot ID | A0A2J5Q928 |
| Locus tag | NUJ53_RS26415 | Protein ID | WP_004098919.1 |
| Coordinates | 111348..111830 (-) | Length | 161 a.a. |
Antitoxin (Protein)
| Gene name | tacA | Uniprot ID | A0A7D3T1D0 |
| Locus tag | NUJ53_RS26420 | Protein ID | WP_004213599.1 |
| Coordinates | 111818..112084 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NUJ53_RS26395 (NUJ53_26395) | 106702..108048 | + | 1347 | WP_011154555.1 | dihydroorotase | - |
| NUJ53_RS26400 (NUJ53_26400) | 108112..109134 | + | 1023 | WP_004214536.1 | porphobilinogen synthase | - |
| NUJ53_RS26405 (NUJ53_26405) | 109309..109704 | + | 396 | Protein_128 | IS3 family transposase | - |
| NUJ53_RS26410 (NUJ53_26410) | 109700..110927 | - | 1228 | Protein_129 | IS3 family transposase | - |
| NUJ53_RS26415 (NUJ53_26415) | 111348..111830 | - | 483 | WP_004098919.1 | GNAT family N-acetyltransferase | Toxin |
| NUJ53_RS26420 (NUJ53_26420) | 111818..112084 | - | 267 | WP_004213599.1 | DUF1778 domain-containing protein | Antitoxin |
| NUJ53_RS26425 (NUJ53_26425) | 112279..112509 | - | 231 | WP_004213598.1 | hypothetical protein | - |
| NUJ53_RS26430 (NUJ53_26430) | 112523..112726 | - | 204 | WP_004213596.1 | HHA domain-containing protein | - |
| NUJ53_RS26435 (NUJ53_26435) | 112787..113280 | - | 494 | Protein_134 | DNA-binding protein | - |
| NUJ53_RS26440 (NUJ53_26440) | 113322..116291 | - | 2970 | WP_004213592.1 | Tn3 family transposase | - |
| NUJ53_RS26445 (NUJ53_26445) | 116294..116851 | - | 558 | WP_004213590.1 | recombinase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Mobilizable plasmid | - | rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..235915 | 235915 | |
| - | inside | IScluster/Tn | - | - | 109700..116851 | 7151 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17335.06 Da Isoelectric Point: 10.0704
>T253668 WP_004098919.1 NZ_CP102439:c111830-111348 [Klebsiella pneumoniae]
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
VGRITAPEPLSSAHQLAEFVSGETVLDEWLKQRGLKNQALGAARTFVVCKKGTKKVAGFYSLATGSVNHTEATGSLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYAHHGFKASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J5Q928 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A7D3T1D0 |