Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 57968..58878 Replicon plasmid unnamed1
Accession NZ_CP102439
Organism Klebsiella pneumoniae strain hvKP248

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NUJ53_RS26110 Protein ID WP_004026354.1
Coordinates 58408..58878 (+) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag NUJ53_RS26105 Protein ID WP_004026357.1
Coordinates 57968..58411 (+) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUJ53_RS26075 (NUJ53_26075) 52986..53507 + 522 WP_004213635.1 ferric citrate uptake sigma factor FecI -
NUJ53_RS26080 (NUJ53_26080) 53504..54457 + 954 Protein_63 fec operon regulator FecR -
NUJ53_RS26085 (NUJ53_26085) 54544..56670 + 2127 WP_029884227.1 TonB-dependent Fe(3+) dicitrate receptor FecA -
NUJ53_RS26090 (NUJ53_26090) 56745..56864 + 120 Protein_65 Fe3+-citrate ABC transporter substrate-binding protein -
NUJ53_RS26095 (NUJ53_26095) 57045..57266 + 222 WP_004213643.1 DUF2188 domain-containing protein -
NUJ53_RS26100 (NUJ53_26100) 57364..57867 + 504 Protein_67 DUF4113 domain-containing protein -
NUJ53_RS26105 (NUJ53_26105) 57968..58411 + 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
NUJ53_RS26110 (NUJ53_26110) 58408..58878 + 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NUJ53_RS26115 (NUJ53_26115) 59333..59521 - 189 WP_223271245.1 hypothetical protein -
NUJ53_RS26120 (NUJ53_26120) 60135..60395 - 261 WP_004026352.1 hypothetical protein -
NUJ53_RS26125 (NUJ53_26125) 60966..62147 - 1182 WP_004883380.1 IS481 family transposase -
NUJ53_RS26130 (NUJ53_26130) 62219..62377 + 159 WP_004181898.1 type I toxin-antitoxin system Hok family toxin -
NUJ53_RS26135 (NUJ53_26135) 62756..62998 - 243 WP_071826037.1 hypothetical protein -
NUJ53_RS26140 (NUJ53_26140) 63074..63238 - 165 WP_011154586.1 hypothetical protein -
NUJ53_RS26145 (NUJ53_26145) 63355..63516 - 162 WP_164507110.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - rmpA / iroN / iroD / iroC / iroB / iucA / iucB / iucC / iucD / iutA / rmpA2 1..235915 235915
- flank IS/Tn - - 60966..62147 1181


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T253667 WP_004026354.1 NZ_CP102439:58408-58878 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT253667 WP_004026357.1 NZ_CP102439:57968-58411 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References