Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3990755..3991374 Replicon chromosome
Accession NZ_CP102438
Organism Klebsiella pneumoniae strain hvKP248

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NUJ53_RS19630 Protein ID WP_002892050.1
Coordinates 3991156..3991374 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NUJ53_RS19625 Protein ID WP_002892066.1
Coordinates 3990755..3991129 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NUJ53_RS19615 (3985907) 3985907..3987100 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NUJ53_RS19620 (3987123) 3987123..3990269 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
NUJ53_RS19625 (3990755) 3990755..3991129 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NUJ53_RS19630 (3991156) 3991156..3991374 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NUJ53_RS19635 (3991533) 3991533..3992099 + 567 WP_002892030.1 maltose O-acetyltransferase -
NUJ53_RS19640 (3992071) 3992071..3992211 - 141 WP_004147370.1 hypothetical protein -
NUJ53_RS19645 (3992232) 3992232..3992702 + 471 WP_002892026.1 YlaC family protein -
NUJ53_RS19650 (3992709) 3992709..3994166 - 1458 WP_029883993.1 PLP-dependent aminotransferase family protein -
NUJ53_RS19655 (3994267) 3994267..3994965 + 699 WP_002892021.1 GNAT family protein -
NUJ53_RS19660 (3994962) 3994962..3995102 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NUJ53_RS19665 (3995102) 3995102..3995365 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T253663 WP_002892050.1 NZ_CP102438:3991156-3991374 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT253663 WP_002892066.1 NZ_CP102438:3990755-3991129 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References