Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 166264..166934 Replicon plasmid pK194-P1
Accession NZ_CP102436
Organism Klebsiella pneumoniae strain K194

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NR799_RS26265 Protein ID WP_004213072.1
Coordinates 166264..166707 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NR799_RS26270 Protein ID WP_004213073.1
Coordinates 166704..166934 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR799_RS26235 (NR799_26235) 161466..162434 - 969 WP_013362812.1 IS5-like element IS903B family transposase -
NR799_RS26240 (NR799_26240) 162514..163482 - 969 WP_013362812.1 IS5-like element IS903B family transposase -
NR799_RS26245 (NR799_26245) 163564..163967 + 404 Protein_177 GAF domain-containing protein -
NR799_RS26250 (NR799_26250) 164485..165120 - 636 Protein_178 mucoid phenotype regulator RmpA2 -
NR799_RS26255 (NR799_26255) 165537..165841 + 305 Protein_179 transposase -
NR799_RS26260 (NR799_26260) 165864..166115 - 252 WP_186987481.1 hypothetical protein -
NR799_RS26265 (NR799_26265) 166264..166707 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NR799_RS26270 (NR799_26270) 166704..166934 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NR799_RS26275 (NR799_26275) 167542..168675 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NR799_RS26280 (NR799_26280) 168691..168984 + 294 WP_004213076.1 hypothetical protein -
NR799_RS26285 (NR799_26285) 168974..169180 - 207 WP_004213077.1 hypothetical protein -
NR799_RS26290 (NR799_26290) 169532..169822 + 291 WP_004213078.1 hypothetical protein -
NR799_RS26295 (NR799_26295) 169812..170711 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroB / iroC / iroD / iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..241781 241781


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T253647 WP_004213072.1 NZ_CP102436:c166707-166264 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT253647 WP_004213073.1 NZ_CP102436:c166934-166704 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References