Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 3917661..3918315 | Replicon | chromosome |
Accession | NZ_CP102435 | ||
Organism | Klebsiella pneumoniae strain K194 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | R4YHX2 |
Locus tag | NR799_RS19280 | Protein ID | WP_004144731.1 |
Coordinates | 3917661..3918068 (-) | Length | 136 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | NR799_RS19285 | Protein ID | WP_002916312.1 |
Coordinates | 3918049..3918315 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NR799_RS19260 (NR799_19260) | 3913661..3915394 | - | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
NR799_RS19265 (NR799_19265) | 3915400..3916113 | - | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
NR799_RS19270 (NR799_19270) | 3916136..3917032 | - | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
NR799_RS19275 (NR799_19275) | 3917133..3917654 | + | 522 | WP_002916308.1 | flavodoxin FldB | - |
NR799_RS19280 (NR799_19280) | 3917661..3918068 | - | 408 | WP_004144731.1 | protein YgfX | Toxin |
NR799_RS19285 (NR799_19285) | 3918049..3918315 | - | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
NR799_RS19290 (NR799_19290) | 3918561..3919544 | + | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
NR799_RS19295 (NR799_19295) | 3919695..3920354 | - | 660 | WP_002916317.1 | hemolysin III family protein | - |
NR799_RS19300 (NR799_19300) | 3920518..3920829 | - | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
NR799_RS19305 (NR799_19305) | 3920879..3921607 | + | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
NR799_RS19310 (NR799_19310) | 3921726..3923159 | + | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 136 a.a. Molecular weight: 15936.69 Da Isoelectric Point: 11.4778
>T253638 WP_004144731.1 NZ_CP102435:c3918068-3917661 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNAE
WEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 408 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A378E4P6 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |