Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 938114..938733 Replicon chromosome
Accession NZ_CP102435
Organism Klebsiella pneumoniae strain K194

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NR799_RS04475 Protein ID WP_002892050.1
Coordinates 938114..938332 (-) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NR799_RS04480 Protein ID WP_002892066.1
Coordinates 938359..938733 (-) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NR799_RS04440 (NR799_04440) 934161..934424 + 264 WP_002892011.1 type B 50S ribosomal protein L31 -
NR799_RS04445 (NR799_04445) 934424..934564 + 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NR799_RS04450 (NR799_04450) 934561..935259 - 699 WP_002892021.1 GNAT family protein -
NR799_RS04455 (NR799_04455) 935360..936811 + 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NR799_RS04460 (NR799_04460) 936786..937256 - 471 WP_002892026.1 YlaC family protein -
NR799_RS04465 (NR799_04465) 937277..937417 + 141 WP_004147370.1 hypothetical protein -
NR799_RS04470 (NR799_04470) 937389..937955 - 567 WP_002892030.1 maltose O-acetyltransferase -
NR799_RS04475 (NR799_04475) 938114..938332 - 219 WP_002892050.1 HHA domain-containing protein Toxin
NR799_RS04480 (NR799_04480) 938359..938733 - 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NR799_RS04485 (NR799_04485) 939219..942365 - 3147 WP_020326861.1 multidrug efflux RND transporter permease subunit AcrB -
NR799_RS04490 (NR799_04490) 942388..943581 - 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T253632 WP_002892050.1 NZ_CP102435:c938332-938114 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT253632 WP_002892066.1 NZ_CP102435:c938733-938359 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References