Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-DUF971 |
Location | 84141..84739 | Replicon | plasmid unnamed2 |
Accession | NZ_CP102430 | ||
Organism | Pseudomonas psychrotolerans strain YY7 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | NRG74_RS24325 | Protein ID | WP_257706796.1 |
Coordinates | 84141..84443 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | A0A178LES3 |
Locus tag | NRG74_RS24330 | Protein ID | WP_064308223.1 |
Coordinates | 84440..84739 (+) | Length | 100 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRG74_RS24285 (NRG74_24285) | 79172..79375 | - | 204 | WP_257706790.1 | hypothetical protein | - |
NRG74_RS24290 (NRG74_24290) | 79385..79597 | - | 213 | WP_074585490.1 | hypothetical protein | - |
NRG74_RS24295 (NRG74_24295) | 79681..81363 | - | 1683 | WP_257706791.1 | DNA cytosine methyltransferase | - |
NRG74_RS24300 (NRG74_24300) | 81415..81657 | - | 243 | WP_257706792.1 | hypothetical protein | - |
NRG74_RS24305 (NRG74_24305) | 81800..82891 | - | 1092 | WP_257706793.1 | hypothetical protein | - |
NRG74_RS24310 (NRG74_24310) | 82952..83170 | - | 219 | WP_257706794.1 | hypothetical protein | - |
NRG74_RS24315 (NRG74_24315) | 83225..83545 | - | 321 | WP_257706807.1 | theronine dehydrogenase | - |
NRG74_RS24320 (NRG74_24320) | 83575..83943 | - | 369 | WP_257706795.1 | hypothetical protein | - |
NRG74_RS24325 (NRG74_24325) | 84141..84443 | + | 303 | WP_257706796.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NRG74_RS24330 (NRG74_24330) | 84440..84739 | + | 300 | WP_064308223.1 | putative addiction module antidote protein | Antitoxin |
NRG74_RS24335 (NRG74_24335) | 85668..86195 | - | 528 | WP_257706797.1 | hypothetical protein | - |
NRG74_RS24340 (NRG74_24340) | 86246..86728 | - | 483 | WP_257706798.1 | helix-turn-helix domain-containing protein | - |
NRG74_RS24345 (NRG74_24345) | 87219..87647 | + | 429 | WP_257706799.1 | S24 family peptidase | - |
NRG74_RS24350 (NRG74_24350) | 87637..88923 | + | 1287 | WP_257706800.1 | Y-family DNA polymerase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(6)-Id / aph(3'')-Ib | - | 1..98312 | 98312 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11194.80 Da Isoelectric Point: 10.4673
>T253627 WP_257706796.1 NZ_CP102430:84141-84443 [Pseudomonas psychrotolerans]
MKTIKQTATFRNWERKLKDKQAKAIIAARVFRVANGLLGDVQPVGQGISELRIHHGPGYRVYFQQRGNQLVLLLCGGDKS
SQARDIETAKALASQWSDDE
MKTIKQTATFRNWERKLKDKQAKAIIAARVFRVANGLLGDVQPVGQGISELRIHHGPGYRVYFQQRGNQLVLLLCGGDKS
SQARDIETAKALASQWSDDE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|