Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | PumAB/COG3657-DUF971 |
| Location | 34985..35583 | Replicon | plasmid unnamed2 |
| Accession | NZ_CP102430 | ||
| Organism | Pseudomonas psychrotolerans strain YY7 | ||
Toxin (Protein)
| Gene name | PumA | Uniprot ID | - |
| Locus tag | NRG74_RS24050 | Protein ID | WP_257706796.1 |
| Coordinates | 34985..35287 (+) | Length | 101 a.a. |
Antitoxin (Protein)
| Gene name | PumB | Uniprot ID | A0A178LES3 |
| Locus tag | NRG74_RS24055 | Protein ID | WP_064308223.1 |
| Coordinates | 35284..35583 (+) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NRG74_RS24010 (NRG74_24010) | 30016..30219 | - | 204 | WP_257706790.1 | hypothetical protein | - |
| NRG74_RS24015 (NRG74_24015) | 30229..30441 | - | 213 | WP_074585490.1 | hypothetical protein | - |
| NRG74_RS24020 (NRG74_24020) | 30525..32207 | - | 1683 | WP_257706791.1 | DNA cytosine methyltransferase | - |
| NRG74_RS24025 (NRG74_24025) | 32259..32501 | - | 243 | WP_257706792.1 | hypothetical protein | - |
| NRG74_RS24030 (NRG74_24030) | 32644..33735 | - | 1092 | WP_257706793.1 | hypothetical protein | - |
| NRG74_RS24035 (NRG74_24035) | 33796..34014 | - | 219 | WP_257706794.1 | hypothetical protein | - |
| NRG74_RS24040 (NRG74_24040) | 34069..34389 | - | 321 | WP_257706807.1 | theronine dehydrogenase | - |
| NRG74_RS24045 (NRG74_24045) | 34419..34787 | - | 369 | WP_257706795.1 | hypothetical protein | - |
| NRG74_RS24050 (NRG74_24050) | 34985..35287 | + | 303 | WP_257706796.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| NRG74_RS24055 (NRG74_24055) | 35284..35583 | + | 300 | WP_064308223.1 | putative addiction module antidote protein | Antitoxin |
| NRG74_RS24060 (NRG74_24060) | 36512..37039 | - | 528 | WP_257706797.1 | hypothetical protein | - |
| NRG74_RS24065 (NRG74_24065) | 37090..37572 | - | 483 | WP_257706798.1 | helix-turn-helix domain-containing protein | - |
| NRG74_RS24070 (NRG74_24070) | 38063..38491 | + | 429 | WP_257706799.1 | S24 family peptidase | - |
| NRG74_RS24075 (NRG74_24075) | 38481..39767 | + | 1287 | WP_257706800.1 | Y-family DNA polymerase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | aph(6)-Id / aph(3'')-Ib | - | 1..98312 | 98312 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11194.80 Da Isoelectric Point: 10.4673
>T253626 WP_257706796.1 NZ_CP102430:34985-35287 [Pseudomonas psychrotolerans]
MKTIKQTATFRNWERKLKDKQAKAIIAARVFRVANGLLGDVQPVGQGISELRIHHGPGYRVYFQQRGNQLVLLLCGGDKS
SQARDIETAKALASQWSDDE
MKTIKQTATFRNWERKLKDKQAKAIIAARVFRVANGLLGDVQPVGQGISELRIHHGPGYRVYFQQRGNQLVLLLCGGDKS
SQARDIETAKALASQWSDDE
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|