Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 20618..21255 | Replicon | plasmid unnamed1 |
Accession | NZ_CP102429 | ||
Organism | Pseudomonas psychrotolerans strain YY7 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | - |
Locus tag | NRG74_RS22630 | Protein ID | WP_068383192.1 |
Coordinates | 20618..21028 (-) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | A0A1H8Y3I8 |
Locus tag | NRG74_RS22635 | Protein ID | WP_007162476.1 |
Coordinates | 21025..21255 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRG74_RS22625 (NRG74_22625) | 16384..20598 | - | 4215 | WP_257706636.1 | HEAT repeat domain-containing protein | - |
NRG74_RS22630 (NRG74_22630) | 20618..21028 | - | 411 | WP_068383192.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NRG74_RS22635 (NRG74_22635) | 21025..21255 | - | 231 | WP_007162476.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NRG74_RS22640 (NRG74_22640) | 21861..23051 | - | 1191 | WP_257706771.1 | Fic family protein | - |
NRG74_RS22645 (NRG74_22645) | 23359..23613 | + | 255 | WP_068383188.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | - |
NRG74_RS22650 (NRG74_22650) | 23610..23954 | + | 345 | WP_257706637.1 | hypothetical protein | - |
NRG74_RS22655 (NRG74_22655) | 23964..24446 | - | 483 | WP_068383184.1 | hypothetical protein | - |
NRG74_RS22660 (NRG74_22660) | 24443..25435 | - | 993 | WP_257706638.1 | DNA-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | aph(3'')-Ib / aph(6)-Id | - | 1..245277 | 245277 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 15116.52 Da Isoelectric Point: 7.2152
>T253625 WP_068383192.1 NZ_CP102429:c21028-20618 [Pseudomonas psychrotolerans]
VTTYMLDTCICSFIMREHPDAVIRRLVAEVERGNRIVISAITYSEMRFGQIGKKASPKHKVLVDEFVRRLDAVIAWDLRA
VDATVEIMRQLNAAGTPIGSNDTAIAGHAIAIGCTLVTNNVREFSRVPGLVYEDWV
VTTYMLDTCICSFIMREHPDAVIRRLVAEVERGNRIVISAITYSEMRFGQIGKKASPKHKVLVDEFVRRLDAVIAWDLRA
VDATVEIMRQLNAAGTPIGSNDTAIAGHAIAIGCTLVTNNVREFSRVPGLVYEDWV
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|