253617

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 118664..119334 Replicon plasmid pVir-1
Accession NZ_CP102391
Organism Klebsiella pneumoniae strain K64

Toxin (Protein)


Gene name vagD Uniprot ID Q6U619
Locus tag NRF21_RS27130 Protein ID WP_004213072.1
Coordinates 118664..119107 (-) Length 148 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID Q6U620
Locus tag NRF21_RS27135 Protein ID WP_004213073.1
Coordinates 119104..119334 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRF21_RS27095 (NRF21_27095) 114075..114350 + 276 WP_004213932.1 carboxymuconolactone decarboxylase family protein -
NRF21_RS27100 (NRF21_27100) 114413..114904 + 492 WP_011251327.1 DM13 domain-containing protein -
NRF21_RS27105 (NRF21_27105) 114953..115873 + 921 WP_004213934.1 DUF1471 domain-containing protein -
NRF21_RS27110 (NRF21_27110) 115964..116367 + 404 Protein_135 GAF domain-containing protein -
NRF21_RS27115 (NRF21_27115) 116885..117520 - 636 Protein_136 mucoid phenotype regulator RmpA2 -
NRF21_RS27120 (NRF21_27120) 117937..118241 + 305 Protein_137 transposase -
NRF21_RS27125 (NRF21_27125) 118264..118515 - 252 WP_186987481.1 hypothetical protein -
NRF21_RS27130 (NRF21_27130) 118664..119107 - 444 WP_004213072.1 type II toxin-antitoxin system VapC family toxin Toxin
NRF21_RS27135 (NRF21_27135) 119104..119334 - 231 WP_004213073.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NRF21_RS27140 (NRF21_27140) 119942..121075 + 1134 WP_004213075.1 DUF3800 domain-containing protein -
NRF21_RS27145 (NRF21_27145) 121091..121384 + 294 WP_004213076.1 hypothetical protein -
NRF21_RS27150 (NRF21_27150) 121374..121580 - 207 WP_004213077.1 hypothetical protein -
NRF21_RS27155 (NRF21_27155) 121932..122222 + 291 WP_004213078.1 hypothetical protein -
NRF21_RS27160 (NRF21_27160) 122212..123111 + 900 WP_004225022.1 nucleotide-binding protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..193821 193821


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(6-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 148 a.a.        Molecular weight: 16006.74 Da        Isoelectric Point: 9.3642

>T253617 WP_004213072.1 NZ_CP102391:c119107-118664 [Klebsiella pneumoniae]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALRLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFERVPGLVLEDWVKKAALCRVIS

Download         Length: 444 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8677.73 Da        Isoelectric Point: 4.4563

>AT253617 WP_004213073.1 NZ_CP102391:c119334-119104 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFDGVSELEIVREGDSIILRPVRPTWGSFAQLDRAAPDFMAEREDVVSDEGRFEP

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB Q6U619

Antitoxin

Source ID Structure
AlphaFold DB Q6U620

References