Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) /RES-TIGR02293
Location 78601..79511 Replicon plasmid pVir-1
Accession NZ_CP102391
Organism Klebsiella pneumoniae strain K64

Toxin (Protein)


Gene name - Uniprot ID A0A663AYG0
Locus tag NRF21_RS26885 Protein ID WP_004026354.1
Coordinates 78601..79071 (-) Length 157 a.a.

Antitoxin (Protein)


Gene name - Uniprot ID A0A6P1V3Q9
Locus tag NRF21_RS26890 Protein ID WP_004026357.1
Coordinates 79068..79511 (-) Length 148 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRF21_RS26845 (NRF21_26845) 73917..74231 + 315 WP_011251273.1 hypothetical protein -
NRF21_RS26850 (NRF21_26850) 74240..74734 + 495 WP_011251274.1 hypothetical protein -
NRF21_RS26855 (NRF21_26855) 74740..75180 + 441 WP_011251275.1 hypothetical protein -
NRF21_RS26860 (NRF21_26860) 75605..76561 - 957 WP_011251280.1 DsbA family protein -
NRF21_RS26865 (NRF21_26865) 76621..76962 - 342 WP_011251281.1 hypothetical protein -
NRF21_RS26870 (NRF21_26870) 76976..77287 - 312 WP_011251282.1 hypothetical protein -
NRF21_RS26875 (NRF21_26875) 77304..77753 - 450 WP_011251283.1 thioredoxin fold domain-containing protein -
NRF21_RS26885 (NRF21_26885) 78601..79071 - 471 WP_004026354.1 RES family NAD+ phosphorylase Toxin
NRF21_RS26890 (NRF21_26890) 79068..79511 - 444 WP_004026357.1 DUF2384 domain-containing protein Antitoxin
NRF21_RS26895 (NRF21_26895) 79612..80115 - 504 Protein_92 DUF4113 domain-containing protein -
NRF21_RS26900 (NRF21_26900) 80321..81301 - 981 WP_000019473.1 IS5-like element ISKpn26 family transposase -
NRF21_RS26905 (NRF21_26905) 81367..82674 + 1308 Protein_94 FepA family TonB-dependent siderophore receptor -
NRF21_RS26910 (NRF21_26910) 82736..82957 + 222 WP_004213615.1 hypothetical protein -
NRF21_RS26915 (NRF21_26915) 83100..84002 - 903 WP_004213613.1 DMT family inner membrane transporter PEG344 -
NRF21_RS26920 (NRF21_26920) 84075..84476 - 402 WP_214588034.1 LuxR C-terminal-related transcriptional regulator -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..193821 193821
- inside IScluster/Tn - iroN / rmpA 72320..92296 19976


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

RES domain

(3-148)

Antitoxin

Antitoxin Xre-like, helix-turn-helix domain

(30-89)


Sequences

Toxin        


Download         Length: 157 a.a.        Molecular weight: 17515.79 Da        Isoelectric Point: 4.6155

>T253616 WP_004026354.1 NZ_CP102391:c79071-78601 [Klebsiella pneumoniae]
VILYRLTKTKYLSTAWTGYGAKEAGGRWNSVGVSMVYVSETASLTMLETLVHLHAAQIMDSFTLLSIDVPDELIQSANMD
ELPGNWADEDAPQELADYGDAWSFTRSSVALRVPSALSPVEFNYLLNPEHPEFYGIVQKAQQIPFRFDSRLKPDRK

Download         Length: 471 bp

Antitoxin


Download         Length: 148 a.a.        Molecular weight: 16480.80 Da        Isoelectric Point: 10.2498

>AT253616 WP_004026357.1 NZ_CP102391:c79511-79068 [Klebsiella pneumoniae]
MKTFSLSSTPARPQRLWQVAGLNNADGVALLGQINEGLDGKVANRITDWARITQNDLRKMSGIPSTTFSRSVKARFNPEQ
SERLVRIIRVIDRAVDLFEGDKEAAQKWLNEPNRALSWKVPADLMASETGAYEVIKLITRLEHGVYS

Download         Length: 444 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A663AYG0

Antitoxin

Source ID Structure
AlphaFold DB A0A6P1V3Q9

References