Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) vagCD/VapC-VagC
Location 18826..19469 Replicon plasmid pVir-1
Accession NZ_CP102391
Organism Klebsiella pneumoniae strain K64

Toxin (Protein)


Gene name vagD Uniprot ID D8L2J9
Locus tag NRF21_RS26550 Protein ID WP_001044770.1
Coordinates 19053..19469 (+) Length 139 a.a.

Antitoxin (Protein)


Gene name vagC Uniprot ID D5KTK7
Locus tag NRF21_RS26545 Protein ID WP_001261282.1
Coordinates 18826..19056 (+) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRF21_RS26520 (NRF21_26520) 14766..14933 - 168 Protein_17 IS1 family transposase -
NRF21_RS26525 (NRF21_26525) 15237..16166 + 930 WP_004213558.1 Rpn family recombination-promoting nuclease/putative transposase -
NRF21_RS26530 (NRF21_26530) 16311..17090 - 780 WP_004213560.1 site-specific integrase -
NRF21_RS26535 (NRF21_26535) 17087..17908 - 822 WP_004213562.1 hypothetical protein -
NRF21_RS26540 (NRF21_26540) 18453..18869 - 417 WP_164481821.1 hypothetical protein -
NRF21_RS26545 (NRF21_26545) 18826..19056 + 231 WP_001261282.1 type II toxin-antitoxin system VapB family antitoxin Antitoxin
NRF21_RS26550 (NRF21_26550) 19053..19469 + 417 WP_001044770.1 type II toxin-antitoxin system VapC family toxin Toxin
NRF21_RS26555 (NRF21_26555) 19543..21105 + 1563 WP_004206609.1 AAA family ATPase -
NRF21_RS26560 (NRF21_26560) 21090..22112 + 1023 WP_000361404.1 helicase UvrD -
NRF21_RS26565 (NRF21_26565) 22368..23065 + 698 WP_223174630.1 IS1 family transposase -
NRF21_RS26570 (NRF21_26570) 23094..23366 + 273 Protein_27 transposase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Mobilizable plasmid - iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 1..193821 193821


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

PIN domain

(5-129)

Antitoxin

SpoVT-AbrB domain

(7-47)


Sequences

Toxin        


Download         Length: 139 a.a.        Molecular weight: 15106.52 Da        Isoelectric Point: 7.1084

>T253615 WP_001044770.1 NZ_CP102391:19053-19469 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR

Download         Length: 417 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8756.83 Da        Isoelectric Point: 4.4692

>AT253615 WP_001261282.1 NZ_CP102391:18826-19056 [Klebsiella pneumoniae]
MRTVSIFKNGNNRAIRLPRDLDFEGVSELEIVREGDSIILRPVRPTWGSFAQFEKADPDFMAEREDVVSDEGRFNL

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A0H3GYM2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GZG3

References