Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 18826..19469 | Replicon | plasmid pVir-1 |
Accession | NZ_CP102391 | ||
Organism | Klebsiella pneumoniae strain K64 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | D8L2J9 |
Locus tag | NRF21_RS26550 | Protein ID | WP_001044770.1 |
Coordinates | 19053..19469 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | D5KTK7 |
Locus tag | NRF21_RS26545 | Protein ID | WP_001261282.1 |
Coordinates | 18826..19056 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRF21_RS26520 (NRF21_26520) | 14766..14933 | - | 168 | Protein_17 | IS1 family transposase | - |
NRF21_RS26525 (NRF21_26525) | 15237..16166 | + | 930 | WP_004213558.1 | Rpn family recombination-promoting nuclease/putative transposase | - |
NRF21_RS26530 (NRF21_26530) | 16311..17090 | - | 780 | WP_004213560.1 | site-specific integrase | - |
NRF21_RS26535 (NRF21_26535) | 17087..17908 | - | 822 | WP_004213562.1 | hypothetical protein | - |
NRF21_RS26540 (NRF21_26540) | 18453..18869 | - | 417 | WP_164481821.1 | hypothetical protein | - |
NRF21_RS26545 (NRF21_26545) | 18826..19056 | + | 231 | WP_001261282.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
NRF21_RS26550 (NRF21_26550) | 19053..19469 | + | 417 | WP_001044770.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
NRF21_RS26555 (NRF21_26555) | 19543..21105 | + | 1563 | WP_004206609.1 | AAA family ATPase | - |
NRF21_RS26560 (NRF21_26560) | 21090..22112 | + | 1023 | WP_000361404.1 | helicase UvrD | - |
NRF21_RS26565 (NRF21_26565) | 22368..23065 | + | 698 | WP_223174630.1 | IS1 family transposase | - |
NRF21_RS26570 (NRF21_26570) | 23094..23366 | + | 273 | Protein_27 | transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Mobilizable plasmid | - | iroN / rmpA / iucA / iucB / iucC / iucD / iutA / rmpA2 | 1..193821 | 193821 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 15106.52 Da Isoelectric Point: 7.1084
>T253615 WP_001044770.1 NZ_CP102391:19053-19469 [Klebsiella pneumoniae]
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
VNKTYMLDTCICSFIMREQPEAVLKRLEQAVLRGQRIVVSAITYSEMRFGATGPKASPRHVELVDAFCARLDAILPWDRA
AVDATTEIKVALRMAGTPIGPNDTAIAGHAIAAGAVLVTNNTREFERVPGLVLEDWVR
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GYM2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GZG3 |