Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | Hha-TomB/- |
Location | 4093461..4094080 | Replicon | chromosome |
Accession | NZ_CP102390 | ||
Organism | Klebsiella pneumoniae strain K64 |
Toxin (Protein)
Gene name | Hha | Uniprot ID | R8WYV2 |
Locus tag | NRF21_RS20410 | Protein ID | WP_002892050.1 |
Coordinates | 4093862..4094080 (+) | Length | 73 a.a. |
Antitoxin (Protein)
Gene name | TomB | Uniprot ID | J2DPF6 |
Locus tag | NRF21_RS20405 | Protein ID | WP_002892066.1 |
Coordinates | 4093461..4093835 (+) | Length | 125 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NRF21_RS20395 (NRF21_20395) | 4088613..4089806 | + | 1194 | WP_002892072.1 | multidrug efflux RND transporter periplasmic adaptor subunit AcrA | - |
NRF21_RS20400 (NRF21_20400) | 4089829..4092975 | + | 3147 | WP_257606316.1 | multidrug efflux RND transporter permease subunit AcrB | - |
NRF21_RS20405 (NRF21_20405) | 4093461..4093835 | + | 375 | WP_002892066.1 | Hha toxicity modulator TomB | Antitoxin |
NRF21_RS20410 (NRF21_20410) | 4093862..4094080 | + | 219 | WP_002892050.1 | HHA domain-containing protein | Toxin |
NRF21_RS20415 (NRF21_20415) | 4094239..4094805 | + | 567 | WP_002892030.1 | maltose O-acetyltransferase | - |
NRF21_RS20420 (NRF21_20420) | 4094777..4094917 | - | 141 | WP_004147370.1 | hypothetical protein | - |
NRF21_RS20425 (NRF21_20425) | 4094938..4095408 | + | 471 | WP_002892026.1 | YlaC family protein | - |
NRF21_RS20430 (NRF21_20430) | 4095383..4096834 | - | 1452 | WP_002892023.1 | PLP-dependent aminotransferase family protein | - |
NRF21_RS20435 (NRF21_20435) | 4096935..4097633 | + | 699 | WP_002892021.1 | GNAT family protein | - |
NRF21_RS20440 (NRF21_20440) | 4097630..4097770 | - | 141 | WP_002892018.1 | type B 50S ribosomal protein L36 | - |
NRF21_RS20445 (NRF21_20445) | 4097770..4098033 | - | 264 | WP_002892011.1 | type B 50S ribosomal protein L31 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 73 a.a. Molecular weight: 8628.00 Da Isoelectric Point: 8.9008
>T253610 WP_002892050.1 NZ_CP102390:4093862-4094080 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR
Download Length: 219 bp
Antitoxin
Download Length: 125 a.a. Molecular weight: 14368.06 Da Isoelectric Point: 4.8989
>AT253610 WP_002892066.1 NZ_CP102390:4093461-4093835 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC
Download Length: 375 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2P8K6F2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GJ93 |