Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4093461..4094080 Replicon chromosome
Accession NZ_CP102390
Organism Klebsiella pneumoniae strain K64

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag NRF21_RS20410 Protein ID WP_002892050.1
Coordinates 4093862..4094080 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag NRF21_RS20405 Protein ID WP_002892066.1
Coordinates 4093461..4093835 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
NRF21_RS20395 (NRF21_20395) 4088613..4089806 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
NRF21_RS20400 (NRF21_20400) 4089829..4092975 + 3147 WP_257606316.1 multidrug efflux RND transporter permease subunit AcrB -
NRF21_RS20405 (NRF21_20405) 4093461..4093835 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
NRF21_RS20410 (NRF21_20410) 4093862..4094080 + 219 WP_002892050.1 HHA domain-containing protein Toxin
NRF21_RS20415 (NRF21_20415) 4094239..4094805 + 567 WP_002892030.1 maltose O-acetyltransferase -
NRF21_RS20420 (NRF21_20420) 4094777..4094917 - 141 WP_004147370.1 hypothetical protein -
NRF21_RS20425 (NRF21_20425) 4094938..4095408 + 471 WP_002892026.1 YlaC family protein -
NRF21_RS20430 (NRF21_20430) 4095383..4096834 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
NRF21_RS20435 (NRF21_20435) 4096935..4097633 + 699 WP_002892021.1 GNAT family protein -
NRF21_RS20440 (NRF21_20440) 4097630..4097770 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
NRF21_RS20445 (NRF21_20445) 4097770..4098033 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T253610 WP_002892050.1 NZ_CP102390:4093862-4094080 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT253610 WP_002892066.1 NZ_CP102390:4093461-4093835 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References