Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | tad-ata/Tad-HTH_37 |
Location | 262..959 | Replicon | plasmid pDB-4 |
Accession | NZ_CP102388 | ||
Organism | Sphingopyxis sp. DBS4 |
Toxin (Protein)
Gene name | tad | Uniprot ID | T0J3S2 |
Locus tag | NP825_RS23055 | Protein ID | WP_013041565.1 |
Coordinates | 262..636 (+) | Length | 125 a.a. |
Antitoxin (Protein)
Gene name | ata | Uniprot ID | T0G937 |
Locus tag | NP825_RS23060 | Protein ID | WP_006964370.1 |
Coordinates | 633..959 (+) | Length | 109 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP825_RS23055 | 262..636 | + | 375 | WP_013041565.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP825_RS23060 | 633..959 | + | 327 | WP_006964370.1 | helix-turn-helix transcriptional regulator | Antitoxin |
NP825_RS23065 | 959..1201 | + | 243 | WP_013041566.1 | hypothetical protein | - |
NP825_RS23070 | 1194..1493 | + | 300 | WP_013041567.1 | hypothetical protein | - |
NP825_RS23075 | 1514..2626 | - | 1113 | WP_145206862.1 | muramidase | - |
NP825_RS23080 | 2629..4344 | - | 1716 | WP_030092735.1 | P-type conjugative transfer protein TrbL | - |
NP825_RS23085 | 4355..4597 | - | 243 | WP_145206861.1 | EexN family lipoprotein | - |
NP825_RS23090 | 4607..5362 | - | 756 | WP_022675885.1 | P-type conjugative transfer protein TrbJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..84199 | 84199 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 125 a.a. Molecular weight: 13960.67 Da Isoelectric Point: 9.4885
>T253600 WP_013041565.1 NZ_CP102388:262-636 [Sphingopyxis sp. DBS4]
MDTERPVRWVASSKRDFREFPDDVQDVMGYALHLAQQGGQHASTKPLKGFGGAGVVEIIDDHQGDTFRTVYTVKFAEAVY
VLHAFQKKSKQGKATPQADMDLIRTRLKSAEEHHRQHQTPRGTA
MDTERPVRWVASSKRDFREFPDDVQDVMGYALHLAQQGGQHASTKPLKGFGGAGVVEIIDDHQGDTFRTVYTVKFAEAVY
VLHAFQKKSKQGKATPQADMDLIRTRLKSAEEHHRQHQTPRGTA
Download Length: 375 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J7XHG4 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J8A803 |