Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/RHH(antitoxin) |
Location | 137917..138476 | Replicon | plasmid pDB-2 |
Accession | NZ_CP102386 | ||
Organism | Sphingopyxis sp. DBS4 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | NP825_RS22345 | Protein ID | WP_089220675.1 |
Coordinates | 138183..138476 (+) | Length | 98 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | T0J1T8 |
Locus tag | NP825_RS22340 | Protein ID | WP_020819389.1 |
Coordinates | 137917..138186 (+) | Length | 90 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
NP825_RS22335 | 134103..137552 | + | 3450 | WP_089220674.1 | YhaN family protein | - |
NP825_RS22340 | 137917..138186 | + | 270 | WP_020819389.1 | ribbon-helix-helix domain-containing protein | Antitoxin |
NP825_RS22345 | 138183..138476 | + | 294 | WP_089220675.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
NP825_RS22350 | 138516..139127 | - | 612 | WP_089220676.1 | DarT ssDNA thymidine ADP-ribosyltransferase family protein | - |
NP825_RS22355 | 139124..139972 | - | 849 | WP_257551734.1 | toprim domain-containing protein | - |
NP825_RS22360 | 140144..140326 | + | 183 | WP_020819384.1 | hypothetical protein | - |
NP825_RS22365 | 140645..141730 | + | 1086 | WP_257551735.1 | AAA family ATPase | - |
NP825_RS22370 | 141727..142797 | + | 1071 | WP_257551736.1 | ParB/RepB/Spo0J family partition protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..227036 | 227036 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 98 a.a. Molecular weight: 11387.05 Da Isoelectric Point: 7.3579
>T253599 WP_089220675.1 NZ_CP102386:138183-138476 [Sphingopyxis sp. DBS4]
MKIQWTSKASSDLVRLHEHLGPVAPEAAARVVQQLAHAPDRLLDYPRIGEKLEAYEPREIRRIIVGNYEMRYEIAAGTIF
MLRLWHCRENRNFESEQ
MKIQWTSKASSDLVRLHEHLGPVAPEAAARVVQQLAHAPDRLLDYPRIGEKLEAYEPREIRRIIVGNYEMRYEIAAGTIF
MLRLWHCRENRNFESEQ
Download Length: 294 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|