Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-VagC |
| Location | 77490..78166 | Replicon | plasmid pDB-2 |
| Accession | NZ_CP102386 | ||
| Organism | Sphingopyxis sp. DBS4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NP825_RS22040 | Protein ID | WP_257551804.1 |
| Coordinates | 77490..77903 (-) | Length | 138 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NP825_RS22045 | Protein ID | WP_257551805.1 |
| Coordinates | 77900..78166 (-) | Length | 89 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP825_RS22000 | 72602..72886 | - | 285 | WP_257551797.1 | hypothetical protein | - |
| NP825_RS22005 | 72898..73593 | - | 696 | WP_257551798.1 | hypothetical protein | - |
| NP825_RS22010 | 73914..74585 | + | 672 | WP_257551799.1 | hypothetical protein | - |
| NP825_RS22015 | 74578..75450 | + | 873 | WP_257551800.1 | nucleotidyl transferase AbiEii/AbiGii toxin family protein | - |
| NP825_RS22020 | 75590..75895 | - | 306 | WP_257551801.1 | hypothetical protein | - |
| NP825_RS22025 | 75900..76289 | - | 390 | WP_257551802.1 | hypothetical protein | - |
| NP825_RS22030 | 76294..76767 | - | 474 | WP_257551803.1 | hypothetical protein | - |
| NP825_RS22035 | 76764..77282 | - | 519 | WP_020818772.1 | hypothetical protein | - |
| NP825_RS22040 | 77490..77903 | - | 414 | WP_257551804.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NP825_RS22045 | 77900..78166 | - | 267 | WP_257551805.1 | AbrB/MazE/SpoVT family DNA-binding domain-containing protein | Antitoxin |
| NP825_RS22050 | 78351..78815 | - | 465 | WP_257551806.1 | DUF736 domain-containing protein | - |
| NP825_RS22055 | 79041..80696 | - | 1656 | WP_257551807.1 | ATP-binding protein | - |
| NP825_RS22060 | 80781..81134 | - | 354 | WP_257551808.1 | DUF3768 domain-containing protein | - |
| NP825_RS22065 | 81131..82109 | - | 979 | Protein_84 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..227036 | 227036 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 138 a.a. Molecular weight: 14601.68 Da Isoelectric Point: 4.4056
>T253598 WP_257551804.1 NZ_CP102386:c77903-77490 [Sphingopyxis sp. DBS4]
VSGLYMLDTNTVSELARNPQGSVAARVAEVGPDAICVSIITAAELRYGCARAGSPRLLAQIEAILDSLQILALDVPADTE
YAGIRAELEAAGKPIGPNDWFIAAHAYALEAVLVTANITDFSRIRALKVENWITDLH
VSGLYMLDTNTVSELARNPQGSVAARVAEVGPDAICVSIITAAELRYGCARAGSPRLLAQIEAILDSLQILALDVPADTE
YAGIRAELEAAGKPIGPNDWFIAAHAYALEAVLVTANITDFSRIRALKVENWITDLH
Download Length: 414 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|