Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | vapBC/VapC-Phd |
| Location | 3022695..3023398 | Replicon | chromosome |
| Accession | NZ_CP102384 | ||
| Organism | Sphingopyxis sp. DBS4 | ||
Toxin (Protein)
| Gene name | vapC | Uniprot ID | - |
| Locus tag | NP825_RS14440 | Protein ID | WP_257544735.1 |
| Coordinates | 3022964..3023398 (+) | Length | 145 a.a. |
Antitoxin (Protein)
| Gene name | vapB | Uniprot ID | - |
| Locus tag | NP825_RS14435 | Protein ID | WP_257544733.1 |
| Coordinates | 3022695..3022967 (+) | Length | 91 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NP825_RS14405 | 3018578..3019090 | - | 513 | WP_257544721.1 | sigma-70 family RNA polymerase sigma factor | - |
| NP825_RS14410 | 3019087..3019581 | - | 495 | WP_257544723.1 | hypothetical protein | - |
| NP825_RS14415 | 3019964..3020605 | + | 642 | WP_257544725.1 | hypothetical protein | - |
| NP825_RS14420 | 3020872..3021792 | - | 921 | WP_257544727.1 | HEPN domain-containing protein | - |
| NP825_RS14425 | 3022221..3022451 | + | 231 | WP_257544729.1 | AlpA family phage regulatory protein | - |
| NP825_RS14430 | 3022453..3022635 | + | 183 | WP_257544731.1 | hypothetical protein | - |
| NP825_RS14435 | 3022695..3022967 | + | 273 | WP_257544733.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| NP825_RS14440 | 3022964..3023398 | + | 435 | WP_257544735.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
| NP825_RS14445 | 3023395..3025029 | + | 1635 | WP_257544737.1 | recombinase family protein | - |
| NP825_RS14450 | 3025125..3026009 | - | 885 | WP_257544739.1 | metal-dependent hydrolase | - |
| NP825_RS14455 | 3026088..3026675 | + | 588 | WP_257544741.1 | TetR/AcrR family transcriptional regulator | - |
| NP825_RS14460 | 3026855..3027898 | + | 1044 | WP_257544743.1 | GTPase ObgE | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 145 a.a. Molecular weight: 15836.96 Da Isoelectric Point: 4.7636
>T253596 WP_257544735.1 NZ_CP102384:3022964-3023398 [Sphingopyxis sp. DBS4]
VSFLLDTNVISEGAKPRPDAGVMDWLASIDEEQLHLSIVSLAELRHGVERLDAGRRKTALDNWLTEQLPLRFDDRLLPVD
AETADAWGRIVAAAQAVGRPIGAMDAFIAAAAKRHQLTLVTRNVVDFEATGIRLFNPWSQGDQP
VSFLLDTNVISEGAKPRPDAGVMDWLASIDEEQLHLSIVSLAELRHGVERLDAGRRKTALDNWLTEQLPLRFDDRLLPVD
AETADAWGRIVAAAQAVGRPIGAMDAFIAAAAKRHQLTLVTRNVVDFEATGIRLFNPWSQGDQP
Download Length: 435 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|