Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yfjZ-ypjF/CbtA-CbeA |
| Location | 2648220..2648887 | Replicon | chromosome |
| Accession | NZ_CP102380 | ||
| Organism | Escherichia coli strain BM28 | ||
Toxin (Protein)
| Gene name | ypjF | Uniprot ID | Q46953 |
| Locus tag | NR349_RS12940 | Protein ID | WP_001094400.1 |
| Coordinates | 2648558..2648887 (+) | Length | 110 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | P52141 |
| Locus tag | NR349_RS12935 | Protein ID | WP_000072690.1 |
| Coordinates | 2648220..2648537 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| NR349_RS12905 (2643272) | 2643272..2644281 | - | 1010 | Protein_2520 | arsenic transporter | - |
| NR349_RS12910 (2644423) | 2644423..2646126 | + | 1704 | WP_000896263.1 | protein YfjW | - |
| NR349_RS12915 (2646698) | 2646698..2646921 | + | 224 | Protein_2522 | DUF905 domain-containing protein | - |
| NR349_RS12920 (2647024) | 2647024..2647482 | + | 459 | WP_000211841.1 | antirestriction protein | - |
| NR349_RS12925 (2647491) | 2647491..2647973 | + | 483 | WP_001407480.1 | RadC family protein | - |
| NR349_RS12930 (2647982) | 2647982..2648182 | + | 201 | WP_001395452.1 | DUF987 domain-containing protein | - |
| NR349_RS12935 (2648220) | 2648220..2648537 | + | 318 | WP_000072690.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| NR349_RS12940 (2648558) | 2648558..2648887 | + | 330 | WP_001094400.1 | type IV toxin-antitoxin system toxin YpjF | Toxin |
| NR349_RS12945 (2649251) | 2649251..2653829 | - | 4579 | Protein_2528 | adhesin-like autotransporter YpjA/EhaD | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 110 a.a. Molecular weight: 12308.21 Da Isoelectric Point: 7.2761
>T253583 WP_001094400.1 NZ_CP102380:2648558-2648887 [Escherichia coli]
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
MNTLPATISQAAKPCLSPVAVWQMLLTRLLEQHYGLTLNDTPFSDETVIKEHIDAGITLADAVNFLVEKYELVRIDHRGF
SWQQQSPYISVVDILRARRSTGLLKTNVK
Download Length: 330 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A373F4I3 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| PDB | 2EA9 | |
| PDB | 2JN7 | |
| AlphaFold DB | P52141 |