Detailed information of TA system
Overview
TA module
Type | II | Classification (family/domain) | relE-pasA/RelE-HTH |
Location | 4829591..4830072 | Replicon | chromosome |
Accession | NC_015635 | ||
Organism | Microlunatus phosphovorus NM-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | F5XTU7 |
Locus tag | MLP_RS21900 | Protein ID | WP_013865380.1 |
Coordinates | 4829809..4830072 (+) | Length | 88 a.a. |
Antitoxin (Protein)
Gene name | pasA | Uniprot ID | F5XTU6 |
Locus tag | MLP_RS21895 | Protein ID | WP_013865379.1 |
Coordinates | 4829591..4829812 (+) | Length | 74 a.a. |
Genomic Context
Location: 4825936..4826682 (747 bp)
Type: Others
Protein ID: WP_013865372.1
Type: Others
Protein ID: WP_013865372.1
Location: 4826679..4827512 (834 bp)
Type: Others
Protein ID: WP_013865373.1
Type: Others
Protein ID: WP_013865373.1
Location: 4827466..4827762 (297 bp)
Type: Others
Protein ID: WP_013865374.1
Type: Others
Protein ID: WP_013865374.1
Location: 4829591..4829812 (222 bp)
Type: Antitoxin
Protein ID: WP_013865379.1
Type: Antitoxin
Protein ID: WP_013865379.1
Location: 4829809..4830072 (264 bp)
Type: Toxin
Protein ID: WP_013865380.1
Type: Toxin
Protein ID: WP_013865380.1
Location: 4830107..4830913 (807 bp)
Type: Others
Protein ID: WP_013865381.1
Type: Others
Protein ID: WP_013865381.1
Location: 4832672..4833001 (330 bp)
Type: Others
Protein ID: WP_013865384.1
Type: Others
Protein ID: WP_013865384.1
Location: 4827753..4828106 (354 bp)
Type: Others
Protein ID: WP_013865375.1
Type: Others
Protein ID: WP_013865375.1
Location: 4828103..4828471 (369 bp)
Type: Others
Protein ID: WP_013865376.1
Type: Others
Protein ID: WP_013865376.1
Location: 4828533..4828967 (435 bp)
Type: Others
Protein ID: WP_041793204.1
Type: Others
Protein ID: WP_041793204.1
Location: 4828960..4829364 (405 bp)
Type: Others
Protein ID: WP_083843910.1
Type: Others
Protein ID: WP_083843910.1
Location: 4831226..4832077 (852 bp)
Type: Others
Protein ID: WP_013865382.1
Type: Others
Protein ID: WP_013865382.1
Location: 4832202..4832627 (426 bp)
Type: Others
Protein ID: WP_041790446.1
Type: Others
Protein ID: WP_041790446.1
Location: 4833068..4833595 (528 bp)
Type: Others
Protein ID: WP_013865385.1
Type: Others
Protein ID: WP_013865385.1
Location: 4833592..4834152 (561 bp)
Type: Others
Protein ID: WP_013865386.1
Type: Others
Protein ID: WP_013865386.1
Loading, please wait
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
MLP_RS21860 | 4825936..4826682 | + | 747 | WP_013865372.1 | hypothetical protein | - |
MLP_RS21865 | 4826679..4827512 | + | 834 | WP_013865373.1 | hypothetical protein | - |
MLP_RS21870 | 4827466..4827762 | + | 297 | WP_013865374.1 | hypothetical protein | - |
MLP_RS21875 | 4827753..4828106 | - | 354 | WP_013865375.1 | TfoX/Sxy family protein | - |
MLP_RS21880 | 4828103..4828471 | - | 369 | WP_013865376.1 | nuclear transport factor 2 family protein | - |
MLP_RS21885 | 4828533..4828967 | - | 435 | WP_041793204.1 | SRPBCC domain-containing protein | - |
MLP_RS21890 | 4828960..4829364 | - | 405 | WP_083843910.1 | metalloregulator ArsR/SmtB family transcription factor | - |
MLP_RS21895 | 4829591..4829812 | + | 222 | WP_013865379.1 | ribbon-helix-helix protein, CopG family | Antitoxin |
MLP_RS21900 | 4829809..4830072 | + | 264 | WP_013865380.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
MLP_RS21905 | 4830107..4830913 | + | 807 | WP_013865381.1 | aminoglycoside phosphotransferase family protein | - |
MLP_RS21910 | 4831226..4832077 | - | 852 | WP_013865382.1 | hypothetical protein | - |
MLP_RS21915 | 4832202..4832627 | - | 426 | WP_041790446.1 | NAD(+)--rifampin ADP-ribosyltransferase | - |
MLP_RS21920 | 4832672..4833001 | + | 330 | WP_013865384.1 | hypothetical protein | - |
MLP_RS21925 | 4833068..4833595 | - | 528 | WP_013865385.1 | flavin reductase family protein | - |
MLP_RS21930 | 4833592..4834152 | - | 561 | WP_013865386.1 | NAD(P)H-dependent oxidoreductase | - |
Associated MGEs
Loading, please wait
MGE detail | Similar MGEs | Relative position | MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
No matching records found |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 88 a.a. Molecular weight: 10132.60 Da Isoelectric Point: 9.9075
>T25358 WP_013865380.1 NC_015635:4829809-4830072 [Microlunatus phosphovorus NM-1]
VTHWHLETSPQFDKTARKLDQQTLHRVRAHLDQVCELEDPRTRGKGLTGKLAGYWRYRIGDYRVIVEIRDHALVIIAITI
GHRSGVY
VTHWHLETSPQFDKTARKLDQQTLHRVRAHLDQVCELEDPRTRGKGLTGKLAGYWRYRIGDYRVIVEIRDHALVIIAITI
GHRSGVY
Download Length: 264 bp
>T25358 NC_015635:4829809-4830072 [Microlunatus phosphovorus NM-1]
GTGACGCACTGGCATTTGGAGACCTCACCCCAGTTCGACAAAACGGCACGCAAGCTCGACCAACAGACACTGCATCGCGT
CCGGGCCCACCTTGACCAGGTCTGCGAACTCGAAGACCCACGCACTCGCGGCAAAGGACTGACGGGCAAGCTCGCCGGGT
ACTGGCGGTACCGGATCGGTGACTACCGCGTGATCGTGGAGATTCGCGACCACGCCTTGGTCATCATCGCGATCACGATC
GGGCACCGATCCGGTGTCTACTGA
GTGACGCACTGGCATTTGGAGACCTCACCCCAGTTCGACAAAACGGCACGCAAGCTCGACCAACAGACACTGCATCGCGT
CCGGGCCCACCTTGACCAGGTCTGCGAACTCGAAGACCCACGCACTCGCGGCAAAGGACTGACGGGCAAGCTCGCCGGGT
ACTGGCGGTACCGGATCGGTGACTACCGCGTGATCGTGGAGATTCGCGACCACGCCTTGGTCATCATCGCGATCACGATC
GGGCACCGATCCGGTGTCTACTGA
Antitoxin
Download Length: 74 a.a. Molecular weight: 8559.49 Da Isoelectric Point: 4.2939
>AT25358 WP_013865379.1 NC_015635:4829591-4829812 [Microlunatus phosphovorus NM-1]
MPLSIRLTEDEEARLTALAERTGRSKTFYVRQAIEAYLEDLEEQYWADEAVREWEASGKRSRPAQQLWDELGV
MPLSIRLTEDEEARLTALAERTGRSKTFYVRQAIEAYLEDLEEQYWADEAVREWEASGKRSRPAQQLWDELGV
Download Length: 222 bp
>AT25358 NC_015635:4829591-4829812 [Microlunatus phosphovorus NM-1]
ATGCCGTTGTCCATTCGGCTGACCGAAGACGAAGAAGCACGTCTGACCGCGCTCGCGGAGCGGACTGGTCGCTCAAAGAC
CTTCTATGTGCGCCAAGCCATCGAGGCCTATCTGGAGGACCTCGAAGAGCAGTACTGGGCTGATGAGGCCGTGCGCGAGT
GGGAGGCCTCGGGCAAGAGATCCCGTCCAGCTCAGCAGTTGTGGGATGAGCTGGGCGTGTGA
ATGCCGTTGTCCATTCGGCTGACCGAAGACGAAGAAGCACGTCTGACCGCGCTCGCGGAGCGGACTGGTCGCTCAAAGAC
CTTCTATGTGCGCCAAGCCATCGAGGCCTATCTGGAGGACCTCGAAGAGCAGTACTGGGCTGATGAGGCCGTGCGCGAGT
GGGAGGCCTCGGGCAAGAGATCCCGTCCAGCTCAGCAGTTGTGGGATGAGCTGGGCGTGTGA